KEGG   Methanoregula boonei: Mboo_1634Help
Entry
Mboo_1634         CDS       T00578                                 

Definition
(GenBank) DNA gyrase, B subunit
  KO
K02470  DNA gyrase subunit B [EC:5.99.1.3]
Organism
mbn  Methanoregula boonei
Brite
Enzymes [BR:mbn01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     Mboo_1634
DNA replication proteins [BR:mbn03032]
 Prokaryotic Type
  DNA Topoisomerases
   Mboo_1634
DNA repair and recombination proteins [BR:mbn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      Mboo_1634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C Toprim HATPase_c HATPase_c_3 DUF3349
Motif
Other DBs
NCBI-ProteinID: ABS56151
JGI: mboo1634
UniProt: A7I8U0
Position
complement(1710082..1712208)
Genome map
AA seq 708 aa AA seqDB search
MTDTYDASHITVLEGLQPVRERPAMYIGSTDTRGLHHLVYEVVDNSIDEALAGFCNRICV
VINKDGSLMVEDNGRGIPVDTMEKNHKSALEVVLTVLHAGGKFDKETYQVSGGLHGVGVS
VVNALSNWLSARVYRDGNIYEMRFSQGKTTLPLTTREETLAELLARYQQWYGEPAPFARA
SPALAVSSGAIPGQVPVTPPGTVTGQLDLTTAAHYPTGNEQEDRASLLATLGNKLTGTRI
HFVPDASIFETTTFDYDVLAHRLRELAFLNAGLTIIITDERTGDSATYCYAGGLSEFVKY
LNEGNEVLHPNPIYITKKDAENKLDLEVAMQYTTGYDEKLYTYVNSVNTREGGTHLEGFR
SAITRGINVVAKRNGIIKENAQVTLRGEDVREGLTSVVSVKMANPQFEGQTKMRLGNSSV
KGIVDSLVYAALTEYFDENPGVLKIIVEKALSAAKAREAARNARDLARRKSSLESAGLPG
KLSDCSERDPAKSEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKAGEHQILKNA
EIQTLINAIGTGIGEKFDPERARYHRIVIMTDADVDGAHIRTLLLTFFYRYMRKLIELGY
VYIAQPPLFRIAKGKEEKYVYKEAEMQKVSAAMGDKGVSIQRYKGLGEMNAQQLWDTTMD
PENRIFLKVSIEDAYEADEMFKTLMGKDVEIRKNFIMRHAKEVTNLDI
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
ttgactgatacttacgatgcatcccacatcacggtactggaaggtctgcagccggttcgg
gagcgccctgccatgtatatcgggagcactgatacccgggggctccatcaccttgtgtat
gaagtcgtggacaactctatcgacgaggcactggccggcttctgcaaccgcatctgcgtt
gtcatcaataaagacgggtcgctcatggtcgaggacaatggccgggggatacccgttgac
acgatggagaagaaccacaagagtgccctcgaagtcgttctgaccgtactccatgcaggc
ggaaaattcgacaaggagacctatcaggtctcaggtggtctccacggtgttggtgtctcc
gtggtgaatgccctctcgaactggctctccgcccgggtgtaccgggacggcaatatctac
gagatgcggttttcgcagggaaaaaccacgttgcccctcacgacccgggaagagaccctt
gccgaacttcttgcacggtaccagcagtggtatggcgaaccggcaccgtttgccagagcc
tccccggcgcttgcggtctcttcgggcgctatcccgggtcaggttcctgtcacacctccc
ggcacggtcaccggccagctcgatctcacgacggccgcccactatcccacgggcaacgaa
caggaagaccgggcatcgctcctcgcaaccctcggcaacaagctgaccggcacccggatc
cacttcgtccctgatgcttcgatcttcgagaccaccactttcgactatgacgtcctcgcc
caccggctccgggaacttgcgttccttaacgccgggctcaccattattatcactgatgag
cggaccggggactcggcgacgtactgttatgcgggcgggctttccgagttcgtgaaatac
ctaaatgaaggcaacgaagtccttcacccgaatcccatctacatcaccaaaaaagacgct
gaaaacaagctcgacctcgaagtcgcgatgcagtacacgacagggtacgacgagaaactc
tatacctatgtcaactcggtcaacacccgtgagggtggcacccatctcgaaggattccgg
agcgctatcacccggggtatcaacgttgttgcaaagagaaacggcatcatcaaggagaat
gcccaggttacgctcaggggcgaagatgtccgcgaaggcctgacctcggtcgtctcggtc
aagatggccaacccccagttcgagggccagaccaagatgcgcctcgggaacagcagcgtg
aaaggtattgtcgattcactcgtttatgctgcacttaccgagtacttcgacgaaaatccg
ggcgtgctcaagatcatcgtcgagaaggcactatcagcagcaaaggcccgtgaagcagcg
aggaatgcccgtgatcttgcacggcgcaagagctcgcttgaatctgccggcctgcccggg
aagctctcggactgttccgagcgcgacccggcaaaaagcgagatctatatcgtggaaggc
gactctgcaggcggcagtgccaagcagggccgcgaccgcaagttccaggccattcttccc
ctccggggtaagatcctcaacgtagaaaaagcaggcgaacaccagatcctgaaaaatgcc
gagatccagacactgattaacgctatcggcaccgggattggcgagaaattcgatcccgaa
cgcgcccggtaccaccgcatcgtcatcatgaccgatgccgatgtcgacggggcgcatatc
cggactcttctcctcacgtttttctaccggtacatgaggaaacttatcgagctcgggtac
gtgtacatcgcccagccgcctcttttcaggattgcgaaaggaaaggaggaaaaatacgtg
tacaaagaggctgagatgcaaaaagtttcagccgccatgggagataagggagtctccatc
cagcggtacaagggtcttggtgagatgaatgcccagcagctctgggacacgaccatggac
cccgagaaccggattttcctcaaggtctcgatcgaggacgcgtacgaggcagacgagatg
ttcaagaccctgatggggaaggatgtggagatacgaaagaatttcatcatgcgccatgca
aaggaggtgacgaaccttgacatctga

DBGET integrated database retrieval system