KEGG   Methanoregula boonei: Mboo_1636Help
Entry
Mboo_1636         CDS       T00578                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Peptidase_A6
Motif
Other DBs
NCBI-ProteinID: ABS56153
JGI: mboo1636
UniProt: A7I8U2
Position
complement(1713461..1714624)
Genome map
AA seq 387 aa AA seqDB search
MSMTRLELRKFVAPELLFGSGARHLAGRYIRNFGAKSVLLVTDPGVRKTGVVDEVGADLQ
REGIGYEIYSDIKPNPTVENVMGGAEFFSQGRCSALIAVGGGSVIDCAKGIGIVSSENRP
ITEFEGVDLITVPPPPLICIPTTAGSSADVSQFAIISDSVRRVKIAIISKALVPDAALID
PEPLLTLPPDLTAYTGLDVLVHAIEAYVSNASSPLTDLYALEAIRRICRSLENAVASPCD
LSLREETMLASMYAGLAFSNASLGAVHAMAHSLGGYLDLPHGKCNALLLDTVIAYNYSSA
RERYLDIGEAMGIAVRSQPEEKRLPAITGEIRRLRAALGITETLADLGVTKSTILLLADN
AIKDACMATNPRDPALEEIRVLYESAL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgacccgccttgaattacggaaatttgttgctcccgaactgctttttgggagt
ggcgcacggcatcttgccggcaggtatatccggaactttggtgcaaaaagcgtgctgctg
gtcacggatcccggcgtccggaaaaccggggtagtcgatgaggtcggtgccgatctccag
cgggaagggataggatacgagatctactcggatatcaagccaaacccgacggtcgaaaat
gtgatggggggcgctgagtttttttcgcaaggaaggtgctctgcacttattgcggtagga
ggaggatcggttatcgattgtgcaaaggggattggcattgtctcttcagaaaaccggccg
atcaccgagttcgaaggcgttgatctgattaccgtgcctcctcccccgctgatctgtatt
cctacaaccgcaggttcaagtgcggatgtctcgcagtttgccattatttctgattctgta
cgcagggtcaagatcgccattatctccaaggcacttgttcccgatgccgcccttatcgat
cctgaacccctgctcacccttcccccggatcttacggcatacaccggccttgatgttctt
gtccatgccatcgaagcctatgtctctaacgcgagctcgccgctgaccgatctttacgcg
cttgaggcgatccggaggatctgccggagtcttgaaaatgccgtagcctccccctgcgat
ctctctctccgcgaagagaccatgcttgcgagtatgtatgccggccttgccttctccaac
gcaagcctcggggcggtgcacgcgatggcgcacagcctgggcgggtaccttgacctgccc
catggaaaatgtaatgcactgctgctcgacacggtcattgcctataactactcatcggcg
cgggaacggtacctggatatcggtgaggctatgggaattgcggttcgttcccagccggaa
gaaaagcgcctcccggcgatcaccggggagatccgccggttgcgcgcagcactggggatc
acggagacgctggccgacctcggcgtaacaaaatccacgatcctgctgcttgccgacaat
gcaataaaagatgcgtgtatggccaccaatccccgggaccctgcccttgaagagatccgg
gtgctctatgaatccgcactctga

DBGET integrated database retrieval system