KEGG   Methanoregula boonei: Mboo_1638Help
Entry
Mboo_1638         CDS       T00578                                 

Definition
(GenBank) cobalamin biosynthesis protein
  KO
K02009  
cobalt/nickel transport protein
Organism
mbn  Methanoregula boonei
Pathway
ABC transporters
Module
Cobalt/nickel transport system
Nickel transport system
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Mboo_1638
Transporters [BR:mbn02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Cobalt transporter [MD:M00245] [OT]
    Mboo_1638
   Nickel transporter [MD:M00246] [OT]
    Mboo_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1715678..1716025
Genome map
AA seq 115 aa AA seqDB search
MSIMDSFNKMDKTFRTLIICLIVLMLLVPIGLIASGTAFGEWGPDELQQAVGYVPAGLQQ
MTGLWSAPLDGYDLPGDHETIPTQTPGYYVSAIVGVIGAGLIAYGVGKVIIKRND
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgagtattatggattcattcaacaaaatggacaaaacgttcaggacactgataatctgc
ctgatcgtcctcatgctccttgtgcccatcggacttatcgcaagcgggactgcctttggg
gaatggggtcccgacgaactccagcaggcggtaggatatgtgccggccgggcttcagcag
atgaccggtctctggagcgctccattggacggctatgatttacccggggaccacgaaacc
attccaacccagacaccgggatattatgtctcagcgatcgttggtgttatcggtgccggc
ctgattgcatatggggtgggaaaagtcatcatcaagaggaatgactga

DBGET integrated database retrieval system