KEGG   Methanoregula boonei: Mboo_1640Help
Entry
Mboo_1640         CDS       T00578                                 

Definition
(GenBank) cobalt ABC transporter, inner membrane subunit CbiQ
  KO
K02008  cobalt/nickel transport system permease protein
Organism
mbn  Methanoregula boonei
Pathway
mbn02010  ABC transporters
Module
mbn_M00245  Cobalt/nickel transport system
mbn_M00246  Nickel transport system
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Mboo_1640
Transporters [BR:mbn02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Cobalt transporter [MD:M00245] [OT]
    Mboo_1640
   Nickel transporter [MD:M00246] [OT]
    Mboo_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiQ
Motif
Other DBs
NCBI-ProteinID: ABS56157
JGI: mboo1640
UniProt: A7I8U6
Position
complement(1718060..1719001)
Genome map
AA seq 313 aa AA seqDB search
MIPEWMQKIEAGPCSCCTVSVGKKKGFVQKAISDIFTFFEECLVNDNIARRKGLLQSLDP
RVKLVSMIALIFAVAMTHDIRLLAIVYLLTLIGAYLSKVEIGFFLKRVWVFIPIFAGIIM
IPILFNVFTPGDTLVTVATLGQNAHVGPFALPPVITITVQGVMLALAFVLRVATCVSAAV
LLFLTTPRDLIFKSLRSLKVPKVYVLTMDMCYRYIFLFADTIRGFYTAKKSRSIKPLPLI
EEQKWVGNRIGYTLVKSLSMSEKVHQAMISRGFTGDIKIMHRYSIHNRDYVACVSMFALS
IFLILVSQNLVRI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatacccgagtggatgcagaagatcgaagcaggcccctgttcctgctgcacggtaagt
gtcggcaagaaaaagggttttgtccagaaggcgatctctgacatcttcacgttctttgaa
gagtgcctggtaaatgacaacatcgcccggcgcaagggcctgctgcagagccttgatccc
cgggtgaaactggtgtcgatgattgcccttatctttgccgtggctatgacccatgacata
cggctacttgcaatcgtatacctgctgacactcatcggggcatacctgagtaaagtcgaa
ataggttttttccttaagcgtgtctgggtatttatcccgatctttgccggcatcatcatg
atcccgattcttttcaatgtttttacccccggtgatacgctggtaaccgttgcaaccctg
ggccagaatgcacatgttggcccgtttgcgctcccgccggttatcaccattacggtccag
ggagtaatgcttgcactggccttcgtgctgcgggtggcaacctgtgtgtctgcggcggta
ctcctgttcctcacgactccccgggatctcatcttcaaatcccttcgctcgcttaaagta
cctaaagtgtatgtgcttacgatggacatgtgctaccggtatattttcctttttgccgat
accatcaggggtttttacacggcaaagaagagcagatccatcaaaccgctaccgttgatc
gaggaacagaaatgggtgggaaaccgtatcggctatacccttgtaaaatccctcagcatg
agcgagaaggtacaccaggccatgatatcgcggggatttaccggggatatcaagatcatg
caccggtattcgatccataatcgtgattacgtagcgtgcgtgagtatgtttgcgctcagc
atcttcctgatactggtgtcccagaacctggtacgaatttaa

DBGET integrated database retrieval system