KEGG   Methanoregula boonei: Mboo_1651Help
Entry
Mboo_1651         CDS       T00578                                 

Definition
(GenBank) hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1727518..1727910
Genome map
AA seq 130 aa AA seqDB search
MQDINICFVPGKVQIRTPFFDRTKVKKILIGKFTINGMDNKTSNPGILRIAAAIILGAIV
GFILFLVVALFIGVFNDHMGMNIPVSTDVAENIFSAVILVIFELGSIIGFCWKVWVTPPT
EEATEEMVVK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatataaatatctgctttgtccccggaaaagtgcagatccggacaccatttttt
gatcggacaaaagttaaaaagattcttatcggcaaatttaccatcaatggtatggataac
aagacgtcaaaccccgggattctgcggattgcagcggctataatccttggagccatcgtg
ggttttattctcttcctggttgtcgctctgtttattggtgtgttcaatgaccacatgggt
atgaacatccccgtgagtactgatgtagcggagaacattttcagtgcggtgatcctggtc
attttcgaactcggttcgatcatcggattctgctggaaagtctgggtcacaccccccaca
gaagaagctactgaagaaatggtggtgaaataa

DBGET integrated database retrieval system