KEGG   Methanoregula boonei: Mboo_1651Help
Entry
Mboo_1651         CDS       T00578                                 

Definition
(GenBank) hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3754 DUF2207 DUF4811
Motif
Other DBs
NCBI-ProteinID: ABS56168
JGI: mboo1651
UniProt: A7I8V7
Position
1727518..1727910
Genome map
AA seq 130 aa AA seqDB search
MQDINICFVPGKVQIRTPFFDRTKVKKILIGKFTINGMDNKTSNPGILRIAAAIILGAIV
GFILFLVVALFIGVFNDHMGMNIPVSTDVAENIFSAVILVIFELGSIIGFCWKVWVTPPT
EEATEEMVVK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatataaatatctgctttgtccccggaaaagtgcagatccggacaccatttttt
gatcggacaaaagttaaaaagattcttatcggcaaatttaccatcaatggtatggataac
aagacgtcaaaccccgggattctgcggattgcagcggctataatccttggagccatcgtg
ggttttattctcttcctggttgtcgctctgtttattggtgtgttcaatgaccacatgggt
atgaacatccccgtgagtactgatgtagcggagaacattttcagtgcggtgatcctggtc
attttcgaactcggttcgatcatcggattctgctggaaagtctgggtcacaccccccaca
gaagaagctactgaagaaatggtggtgaaataa

DBGET integrated database retrieval system