KEGG   Methanoregula boonei: Mboo_1659Help
Entry
Mboo_1659         CDS       T00578                                 

Definition
(GenBank) Protein of unknown function DUF555
  KO
K09731  
uncharacterized protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1736325..1736663)
Genome map
AA seq 112 aa AA seqDB search
MPDYLVTLESAWYIKEAKTLDDAIGIAISEAGKRLNPSAKFVEVEAGMLACPFCERELSS
AIVVADTALVGLILEMKVFRAESKEHASRIAKSVIGKALHEIPLKLLDVQEL
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgcctgactatctggtaactcttgaatcagcgtggtatatcaaggaagcaaagacgctt
gacgatgcaatcgggatcgcgatcagtgaggcgggaaaacgccttaatccctcggcgaag
tttgtcgaggtcgaggcaggtatgcttgcctgcccgttctgcgagcgggaactctccagc
gccattgttgttgccgataccgcgctcgtgggccttatcctggagatgaaagtgttccgt
gccgagtcaaaggagcacgccagccggattgcaaaatcggtgatcgggaaagcccttcac
gagatcccgttgaagctgctggatgtgcaggaactatga

DBGET integrated database retrieval system