KEGG   Methanoregula boonei: Mboo_1662Help
Entry
Mboo_1662         CDS       T00578                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1737721..1738056)
Genome map
AA seq 111 aa AA seqDB search
MGKTGTTLWSQVKGVKGQIRLVPKKEGERKSPGPNQRFKSSINLKKIDQAAAEEQRGGRG
GGARRGGRGGRRGGDRSGGSGMNESTASPLIRRRMRRAKVSALGAKAKSGK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacaggtacaaccctctggtcacaggttaaaggcgtcaagggccagatccgg
ctcgttcccaaaaaggaaggggagcgcaagagcccgggacccaaccagcggttcaagtcc
agtatcaacttaaagaagatcgatcaggccgcagccgaagagcagcgcggtggccggggt
ggcggggcacggcgcggcggccgcggcggaaggcgcggaggcgaccggtccggtggctca
ggcatgaacgaatccacggcaagcccgctcatccgccggcgcatgcgcagggcaaaagtc
tccgccctgggcgcaaaggcaaaatccggaaaataa

DBGET integrated database retrieval system