KEGG   Methanoregula boonei: Mboo_1681Help
Entry
Mboo_1681         CDS       T00578                                 

Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mboo_1681
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1681
   00620 Pyruvate metabolism
    Mboo_1681
   00640 Propanoate metabolism
    Mboo_1681
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mboo_1681
   00680 Methane metabolism
    Mboo_1681
Enzymes [BR:mbn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mboo_1681
Lipid biosynthesis proteins [BR:mbn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mboo_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1756775..1758442
Genome map
AA seq 555 aa AA seqDB search
MGEDQHNMEDYDKTMAAFKIEVPEHFNFGFDVVDAWAKKDRNKLAMIWANQKGEEKKFSF
LDMSSLSNQAANVLLKYGINKGDRVLIMLPRIPEWWIFVVALIKLGAVVCPCPTMLTPRD
IKYRVNKGKFRMVITDLENAGKVEEICNECPTLTCRFLADGERKGWASWPYELLYPAPVS
HHTPSIPDDQKTKSTDPMLIYFTSGTVGEPKMVLHNHGHPLGQTVTARFWQDLRHNDLHF
TVTDTGWAKCGWGKIFGQWIEGACIFVYNFTGKFNATEILPLLEKYQITTFCAPPTIYRM
LILADLDKFDLSSLRHCTSAGEPLNPEVIRVWKAGTGLDIREGYGQSETCCCVAEFPCIE
VRPGSMGKPSPGWNVEIHDEEGRPVGVREEGRIAISVTPPPAGLFVEYLDNPEENKKSFV
NGWYYTGDKVYKDEDGFFWFVGRDDDVIKSSGYRIGPFEVESALLEHPAVQEAAVIGAPD
RLRGLIVKAFVVLNKGYDPSETLIKEIKNYVKKTTAPYKYPRAIEFVAELPKTHSGKIRR
AELRERELRKYREFR
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaagaccagcacaacatggaagactacgacaagacgatggcagcatttaagatc
gaagttcccgaacatttcaacttcggttttgacgtagtcgatgcctgggcaaaaaaggac
cggaacaaactggccatgatctgggcaaaccagaaaggcgaggagaagaagttcagtttc
cttgatatgtccagcctctccaaccaggcggcaaatgtcctcttaaaatacgggatcaac
aagggcgaccgggtcctgatcatgctcccccggatccccgaatggtggatctttgtcgtg
gcgctcatcaagctcggggccgtcgtctgcccctgccccacaatgcttaccccgagggat
atcaaatacagggtgaacaaggggaaattccggatggtgatcaccgatcttgaaaatgca
ggcaaggtcgaggagatctgcaacgagtgcccgacgctcacctgccggttccttgcagat
ggcgagcgtaagggctgggcaagctggccttatgagctcctgtacccggcaccggtctcc
caccacaccccgagcattccggacgatcagaaaacaaagagcaccgacccgatgctgatc
tactttacctcaggcaccgtgggagagccaaagatggtgctccacaaccacggccacccg
ctgggccagaccgtgaccgcccggttctggcaggacctccggcacaacgatctccacttc
acggtcaccgataccggctgggccaagtgcgggtggggcaagatcttcggccagtggatc
gaaggggcctgcatctttgtctacaactttaccgggaagttcaacgcaaccgagatcctg
cccctcctggagaagtaccagatcaccacgttctgtgccccgcctacgatctaccggatg
ctgatccttgccgatctcgacaagttcgacctctcatcattgcggcactgcacgagtgcc
ggcgagcctctcaatcccgaggtgatccgggtctggaaagcgggaaccggccttgatatc
cgcgaaggctacggccagagcgagacctgctgctgcgttgccgagttcccgtgcatcgaa
gtcaggcccggctccatgggcaagccctcgcccggctggaacgtggagatccatgacgag
gagggccgcccggttggcgtccgcgaggagggcaggatcgcaatctccgttactccgccc
ccagcaggcctctttgtggagtacctggacaaccccgaggagaacaagaagtcgtttgtg
aacggctggtactatacaggcgacaaggtgtacaaagatgaagacgggttcttctggttt
gtgggccgggacgatgacgtgatcaaatcgtccggctaccggatcgggccttttgaagtg
gagagtgcgcttcttgaacacccggccgtgcaggaggccgcagtcatcggtgcaccggac
cggctccgggggctgatcgtgaaggcctttgtggtcctcaacaagggatatgacccctcg
gagacgctcataaaagagatcaagaattacgtgaagaagaccacggcgccgtacaagtac
ccccgggcgatcgaattcgtggccgagctccccaagacccattccggcaagatccggcga
gccgagctccgcgaacgggaactgaggaagtaccgggaattccggtaa

DBGET integrated database retrieval system