KEGG   Methanoregula boonei: Mboo_1681Help
Entry
Mboo_1681         CDS       T00578                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn00620  Pyruvate metabolism
mbn00640  Propanoate metabolism
mbn00680  Methane metabolism
mbn00720  Carbon fixation pathways in prokaryotes
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01200  Carbon metabolism
Module
mbn_M00357  Methanogenesis, acetate => methane
mbn_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1681
   00620 Pyruvate metabolism
    Mboo_1681
   00640 Propanoate metabolism
    Mboo_1681
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mboo_1681
   00680 Methane metabolism
    Mboo_1681
Enzymes [BR:mbn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mboo_1681
Lipid biosynthesis proteins [BR:mbn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mboo_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABS56198
JGI: mboo1681
UniProt: A7I8Y7
Position
1756775..1758442
Genome map
AA seq 555 aa AA seqDB search
MGEDQHNMEDYDKTMAAFKIEVPEHFNFGFDVVDAWAKKDRNKLAMIWANQKGEEKKFSF
LDMSSLSNQAANVLLKYGINKGDRVLIMLPRIPEWWIFVVALIKLGAVVCPCPTMLTPRD
IKYRVNKGKFRMVITDLENAGKVEEICNECPTLTCRFLADGERKGWASWPYELLYPAPVS
HHTPSIPDDQKTKSTDPMLIYFTSGTVGEPKMVLHNHGHPLGQTVTARFWQDLRHNDLHF
TVTDTGWAKCGWGKIFGQWIEGACIFVYNFTGKFNATEILPLLEKYQITTFCAPPTIYRM
LILADLDKFDLSSLRHCTSAGEPLNPEVIRVWKAGTGLDIREGYGQSETCCCVAEFPCIE
VRPGSMGKPSPGWNVEIHDEEGRPVGVREEGRIAISVTPPPAGLFVEYLDNPEENKKSFV
NGWYYTGDKVYKDEDGFFWFVGRDDDVIKSSGYRIGPFEVESALLEHPAVQEAAVIGAPD
RLRGLIVKAFVVLNKGYDPSETLIKEIKNYVKKTTAPYKYPRAIEFVAELPKTHSGKIRR
AELRERELRKYREFR
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaagaccagcacaacatggaagactacgacaagacgatggcagcatttaagatc
gaagttcccgaacatttcaacttcggttttgacgtagtcgatgcctgggcaaaaaaggac
cggaacaaactggccatgatctgggcaaaccagaaaggcgaggagaagaagttcagtttc
cttgatatgtccagcctctccaaccaggcggcaaatgtcctcttaaaatacgggatcaac
aagggcgaccgggtcctgatcatgctcccccggatccccgaatggtggatctttgtcgtg
gcgctcatcaagctcggggccgtcgtctgcccctgccccacaatgcttaccccgagggat
atcaaatacagggtgaacaaggggaaattccggatggtgatcaccgatcttgaaaatgca
ggcaaggtcgaggagatctgcaacgagtgcccgacgctcacctgccggttccttgcagat
ggcgagcgtaagggctgggcaagctggccttatgagctcctgtacccggcaccggtctcc
caccacaccccgagcattccggacgatcagaaaacaaagagcaccgacccgatgctgatc
tactttacctcaggcaccgtgggagagccaaagatggtgctccacaaccacggccacccg
ctgggccagaccgtgaccgcccggttctggcaggacctccggcacaacgatctccacttc
acggtcaccgataccggctgggccaagtgcgggtggggcaagatcttcggccagtggatc
gaaggggcctgcatctttgtctacaactttaccgggaagttcaacgcaaccgagatcctg
cccctcctggagaagtaccagatcaccacgttctgtgccccgcctacgatctaccggatg
ctgatccttgccgatctcgacaagttcgacctctcatcattgcggcactgcacgagtgcc
ggcgagcctctcaatcccgaggtgatccgggtctggaaagcgggaaccggccttgatatc
cgcgaaggctacggccagagcgagacctgctgctgcgttgccgagttcccgtgcatcgaa
gtcaggcccggctccatgggcaagccctcgcccggctggaacgtggagatccatgacgag
gagggccgcccggttggcgtccgcgaggagggcaggatcgcaatctccgttactccgccc
ccagcaggcctctttgtggagtacctggacaaccccgaggagaacaagaagtcgtttgtg
aacggctggtactatacaggcgacaaggtgtacaaagatgaagacgggttcttctggttt
gtgggccgggacgatgacgtgatcaaatcgtccggctaccggatcgggccttttgaagtg
gagagtgcgcttcttgaacacccggccgtgcaggaggccgcagtcatcggtgcaccggac
cggctccgggggctgatcgtgaaggcctttgtggtcctcaacaagggatatgacccctcg
gagacgctcataaaagagatcaagaattacgtgaagaagaccacggcgccgtacaagtac
ccccgggcgatcgaattcgtggccgagctccccaagacccattccggcaagatccggcga
gccgagctccgcgaacgggaactgaggaagtaccgggaattccggtaa

DBGET integrated database retrieval system