KEGG   Methanoregula boonei: Mboo_1765Help
Entry
Mboo_1765         CDS       T00578                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mbn  Methanoregula boonei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mboo_1765
   00052 Galactose metabolism
    Mboo_1765
   00500 Starch and sucrose metabolism
    Mboo_1765
   00520 Amino sugar and nucleotide sugar metabolism
    Mboo_1765
Enzymes [BR:mbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mboo_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1847585..1848472
Genome map
AA seq 295 aa AA seqDB search
MKGGQHVRKAVIPAAGLGTRFLPITKAQPKEMLPVVDKPVIQYVVEEAIQSGIDDILIIT
GRNKRAIEDHFDRCFELEVKFSHRKKDPFTESLQALADFPDLHFIRQREQKGLGDAVNLA
GRHCDNEPFAVLLGDTICISPAKEKPCTRQMMDAFERHRRSIIAVEPVAGNKIQDYGIID
GREIEKGVYEIDDIVEKPAPEHAPSNLGAIGRYVLTPEIFFLLADATPGVGGEIQLTDAL
RRLDRPLGLVTNCRRYDIGDKLGWMKSSIELTLEREEFAGEIRPFLSKLLKGEGS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggggccagcatgtgcgcaaggcggtgattcccgcagccggccttggcacgaga
tttctcccaataacaaaagcccaacctaaagagatgctaccggttgtcgacaagccggtg
atccaatacgtagtagaagaggcgatccagtccgggattgacgatatcctgatcataacg
ggcaggaacaaacgggccattgaggatcactttgaccggtgttttgagctggaggtaaag
ttttcccatcgtaaaaaagatccattcacggaatctttacaggcccttgcggatttcccg
gatctccatttcatccgtcagcgggaacaaaaggggcttggggatgcagtaaacctcgcc
gggcgacactgcgataacgaaccatttgccgtactgctgggcgataccatctgcatctct
cctgcaaaggaaaaaccctgtacccgccagatgatggatgcattcgaacgccaccggcga
tcgatcatagcagttgaacccgtagcagggaacaagatacaggattacggcattattgac
ggcagggagatcgaaaagggcgtctacgagatagatgatattgtggaaaaacctgccccg
gagcatgcaccctcaaatcttggggcgatcgggcgctatgtccttaccccggagatcttt
ttcctgcttgccgatgcaacacccggggttggcggcgagatccagcttaccgatgcactc
cgccggctggacaggcccttaggccttgtcaccaactgccgccgttacgatatcggagac
aaactgggctggatgaaatccagcatcgagctcacgctcgaacgcgaggagtttgccggg
gagattcgtccgtttttgtcaaaactcctgaaaggtgaaggttcatga

DBGET integrated database retrieval system