KEGG   Methanoregula boonei: Mboo_1801Help
Entry
Mboo_1801         CDS       T00578                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mbn  Methanoregula boonei
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mboo_1801
Enzymes [BR:mbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mboo_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1879295..1879831
Genome map
AA seq 178 aa AA seqDB search
MQDYGFERIGKRLFAEHLVGGNFGNISVRDGEKGFFVKRTGTYLDDPGDPAFVPFHGEVP
KDASSEYRVHLAVYRKTAYKAIVHAHPPYAVAASLEADEIRPLDSEGIMFCPLIPVTSGD
PGTQGLADAVTAAMLHHKLVIARGHGTFAGGATLDEAFQLTSLAEHACRVIAFRKMFL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcaggattacggctttgaacggataggaaaacggctgtttgcagaacaccttgtcggc
gggaacttcgggaatatcagtgtgcgggacggggagaaaggattttttgtcaaacgaacc
gggacctatcttgatgatcccggggatccggcatttgttccattccatggggaggtccca
aaagatgcctcaagcgagtaccgcgttcacctcgcagtgtacagaaaaactgcatacaaa
gcaattgtccatgcccatcctccctatgctgttgccgcctcgcttgaggcagacgaaatc
cggccgctggacagcgaagggatcatgttctgtccactcatcccggtgacctcaggcgat
cccgggacgcagggtcttgctgacgcggtgacggccgcaatgctgcaccataaactggtc
attgcccgggggcacgggacatttgcgggtggcgcaactctggacgaggcattccagctc
acttcccttgctgaacatgcctgccgggtaatcgcgttcaggaagatgtttctctga

DBGET integrated database retrieval system