KEGG   Methanoregula boonei: Mboo_1941Help
Entry
Mboo_1941         CDS       T00578                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mboo_1941
   01230 Biosynthesis of amino acids
    Mboo_1941
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1941
   00030 Pentose phosphate pathway
    Mboo_1941
   00051 Fructose and mannose metabolism
    Mboo_1941
   00052 Galactose metabolism
    Mboo_1941
  Energy metabolism
   00680 Methane metabolism
    Mboo_1941
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mboo_1941
Enzymes [BR:mbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mboo_1941
Protein phosphatases and associated proteins [BR:mbn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mboo_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2005863..2006918
Genome map
AA seq 351 aa AA seqDB search
MAFTGKIGVLTGGGDCPGLNAAIRAVVRSGIAHGYEVIGIRNGWQGLIANDIFPLSDHLV
SGIISWGGTILGTSRTDPVKNPDDIAALKRALDEQGIGALVVIGGNGTLSAAKEVAEKGV
HLVGIPKTIDNDVFGTDVTIGFDTAVAIVTEAIDRLHTTAESHHRIMILEVMGRRSGRLA
LAAGMAGGADQILVPEIQVLMNEVCSSLEARSRVGKKFSIVVVAEGTRHEDIAGTVVPAC
DRDECGHEKFVGIGNFLGKELERRLSIETRVTVLGHVQRGGSPTAHDRILATRLGIAAVE
QIHTGSFGCMVGMQEGRIVQVPLESVAGRSQGVDPKVYEEAMNVAGITEHK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcattcacaggaaaaatcggcgtgctgactggtggcggagactgtccgggtctcaat
gcggcgatccgtgcggtggtgcgcagcggaattgcacacgggtatgaggtaatcggaatc
cggaacggctggcagggtctcattgccaacgatattttcccgctttcggatcatctggtt
tccgggattatctcgtggggaggaacaatccttggtacgtcccgtaccgatccggtgaaa
aatcctgacgatatcgcagccctcaaacgggcgctggacgagcagggcatcggagctctc
gtggtgatcgggggcaacggaaccctcagtgcagcaaaagaggtggcagaaaagggcgtc
caccttgtggggatcccaaaaaccatcgataacgatgtctttgggactgatgtcactatc
gggttcgatactgcagtagcaattgtgactgaggcgatcgacaggctccacacaaccgcg
gaatcccatcaccggattatgatactggaagtgatgggacgccggtccggccggctcgcg
ctcgcggccgggatggccgggggtgccgaccaaatcctggtaccggagatccaggtactc
atgaatgaagtctgttcgtcccttgaggcacggtcccgggtcgggaaaaaattctcgatt
gtggttgtggcagaagggacccggcacgaagatattgccggaactgtggtcccggcatgt
gacagggatgaatgtggccatgaaaagtttgtcgggattggcaatttcctgggaaaggag
ctggagcggcgtctgtccatcgagacccgggtcacggtgctcggccatgtgcagcgcggg
ggaagcccaactgcacatgaccggatccttgctacacggcttgggatcgcagcggtagag
caaatccacacgggcagttttggctgcatggtcgggatgcaggagggccggatcgtccag
gtacctctggagtccgtagctggccggtcccagggagtcgatcccaaggtatacgaagag
gcaatgaacgtggcaggaatcacggagcacaagtga

DBGET integrated database retrieval system