KEGG   Methanoregula boonei: Mboo_2035Help
Entry
Mboo_2035         CDS       T00578                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mbn  Methanoregula boonei
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mbn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2110660..2111634
Genome map
AA seq 324 aa AA seqDB search
MDNDLEKMAAQCRTFTKEMVDNPYRGLATFFGLPYTESLDNLDIALIGVPIDLGVTDRSG
TRMGPRALRNESRGVGAYNHCTRSTPCTAHRIADVGDVPFRSVYRIEEALDDISAYYRGI
AAAGVTPVTAGGDHSITFPILQGLAPKEKVCLVHFDSHCDTAPPIHGCGYTHGSPMKNTV
EAGLVDAEHSLQIGIRGSSEPLWEFSSASGMRVIHIEEFYEMGWKGAVKEIHDLVGDSPV
YLSFDIDCLDPAFAPGTGTPVAGGMSTFEALQMVRGMQGLDVIGGDLVEVSPPYDHAGIT
ALAGATLLFEILCRAAEARERRGA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggataacgacctggagaagatggcggcgcagtgcaggacttttaccaaagagatggtg
gacaacccgtaccgggggcttgccacgttctttggcctgccgtacaccgaatcgctcgac
aacctcgacattgcgctcatcggggttcccatagatctgggagtcaccgaccggagcgga
acccggatgggcccgagggcattgcgcaacgagtcccggggcgtcggagcctacaaccac
tgcacccgttcgaccccctgcacggcacaccggatcgctgatgtcggagacgtgcccttc
cgttcggtgtaccggatcgaagaagcgctggacgatatctccgcgtactaccgcgggatt
gcggcagccggagtcacccccgtgaccgcgggaggggatcactcgatcaccttcccgatc
ttacagggccttgccccaaaagagaaggtctgcctggtccacttcgattcccactgcgac
accgccccaccgatccatggctgcgggtacacccacggttccccgatgaaaaacacggtg
gaggcagggcttgtggacgctgaacactccctccagatcgggatacggggctcaagcgaa
ccactctgggaattctcctctgcaagcggtatgcgggtgatccacatcgaggagttctac
gagatgggctggaaaggcgcagtaaaagagatccacgaccttgtcggtgacagcccggtg
tacctctcttttgatatcgactgccttgacccggcctttgccccgggcactgggacaccg
gtcgccggcggcatgtccacgtttgaagcgctccagatggtgaggggaatgcagggcctg
gatgtcatcggcggcgacctcgtggaggtctccccaccctacgatcatgcgggtatcacc
gcccttgccggggcgaccctcctctttgagattctctgccgtgcggccgaggcacgggaa
cgccggggggcctga

DBGET integrated database retrieval system