KEGG   Methanoregula boonei: Mboo_2043Help
Entry
Mboo_2043         CDS       T00578                                 

Definition
homoserine O-acetyltransferase (EC:2.3.1.31)
Orthology
K00641  
homoserine O-acetyltransferase [EC:2.3.1.31]
Organism
mbn  Methanoregula boonei
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:mbn00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2119131..2120606)
Genome map
AA seq 491 aa AA seqDB search
MLRGSLGIVTTQYADLPGPFTLESGAVLPEIRIAYETYGRLNKEKSNAILLCHALSGDAH
VAGFHNGETKPGWWDAVVGPGKAFDTERYFVICSNVLGGCKGSTGPSTINPETGKPYGAT
FPVVTIRDMVNAQKLLLDSLGIPELYAVAGGSMGGMQALQWTVSYPDLIKKAVIIATTGY
STPQQIAFNEVGRKAILSDPDWSGGDYYGKKTPAHGLALARMVGHITYLSDESMHAKFGR
SLQGKAQVGFDFSTEFAIESYLHHQGDTFTKRFDANSYLYITKAIDYFDLTKDGSLTTGL
AAAKAAFFVISVTSDWLYPPYQSQEIVTALTTNEREVQYCEIRSNYGHDAFLLESGQLNY
LISRFLSHTVVGDVMARNVECIEEGTTIAVTARRMITSGVNHLPVLSPAGQLVGIVTSWD
IAKAVASNFLWLDEIMSRNVVTTTENEPVDEAARKMEAHSISALPVIDGDSHVIGLITSD
AISTLVGRQNP
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtggctcgctaggcatcgttacgacccagtacgcagacctccccggtcccttt
accctggagagcggggcggtgctgcccgaaataaggattgcctacgagacctacggcagg
ctcaacaaggaaaagagcaacgcgatccttctctgccatgccctctcgggcgacgctcac
gtagccgggttccataacggggaaacaaaacccggctggtgggacgcagtggtagggccg
ggaaaggcgtttgataccgagcgttactttgttatctgcagtaacgtgcttggggggtgt
aagggctcgaccggcccttccaccatcaaccccgaaacgggcaaaccctatggcgcaacc
ttcccggtggtgaccatccgggacatggttaacgcccagaaacttcttcttgacagcctt
ggtattcccgaactctatgcggttgcaggcggctcgatgggggggatgcaggcgctccag
tggactgtctcctacccggatcttataaaaaaggcggtcatcatcgccacgaccggctac
tccaccccccagcagatcgcctttaacgaggtgggccggaaggcgattctctccgatccc
gactggagtggcggggactattacgggaaaaagacccctgcccatggcctcgcccttgcc
cggatggtgggccacatcacctacctctccgatgaatcgatgcacgcgaagttcgggcgc
tcgctccagggaaaggcgcaggtgggctttgatttctccaccgagtttgccatcgagagc
tacctccaccaccagggtgatacgttcacaaaaaggttcgatgcaaactcgtatctctac
atcaccaaggccatcgattactttgatctcaccaaagacgggtccctgaccaccggcctt
gcagcggcaaaggctgcgttctttgttatctccgttacctcggactggctgtaccctcct
taccagtcgcaggagattgttaccgcccttaccacgaacgagcgcgaggtacagtactgc
gagatccggtccaactacggccatgatgcgttcctccttgaatccgggcagctcaactac
ctgatctcccggttcctctcccatactgtcgtaggtgacgtgatggcgaggaacgtggag
tgcatcgaggaaggtaccacgatcgcggttaccgcccggcggatgatcaccagtggtgtc
aatcacctgccggttctctcccctgccggccagctcgtgggaatcgtgacctcgtgggac
attgcaaaggcggtggcttccaatttcctgtggcttgacgagattatgagccggaacgtg
gtcacgaccaccgagaacgagcccgttgacgaggcggcgcgcaagatggaggcccactcg
atctccgcgcttccggtgatcgatggcgactcgcacgtgatcggtcttattacaagcgat
gcgatcagtacccttgtagggagacagaacccgtga

DBGET integrated database retrieval system