KEGG   Mycobacterium bovis AF2122/97: Mb0669Help
Entry
Mb0669            CDS       T00132                                 

Definition
sugar kinase (EC:2.7.-.-)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mbo  Mycobacterium bovis AF2122/97
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mb0669
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mb0669
   00052 Galactose metabolism
    Mb0669
   00500 Starch and sucrose metabolism
    Mb0669
   00520 Amino sugar and nucleotide sugar metabolism
    Mb0669
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mb0669
   00524 Butirosin and neomycin biosynthesis
    Mb0669
Enzymes [BR:mbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mb0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
748806..749714
Genome map
AA seq 302 aa AA seqDB search
MLTLCLDIGGTKIAAGLADPAGTLVHTAQRPTPAYGGAEQVWAAVAEMIADALGVAGGAV
GGVGIASAGPIDLHSGRVSPINIGSWGGFPLRDRVAAAVPGVPVRLGGDGVCMALGEHWL
GAGRGARFLLGLVVSTGVGGGLVLDGAPCLGRTGNAGHVGHVVVDPDGSPCPCGGRGCVE
TIASGPSLARWARANGWSAPPGAGAKELAEAAGAGDPVALRAFRRGAAALAAMIASVGAV
CDLDLAVIGGGVAKSGRLLFEPLRAALADHARLDFLAGLRVVPAELGGAAGLVGAARLAA
IA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctttgcctcgacatcggcggcaccaagatcgccgcgggcctggccgacccg
gccggcacgttggtgcacaccgcccaacgtcccaccccggcgtatggcggagccgaacag
gtctgggccgcggtcgccgagatgatcgccgacgcgctcggcgtggcggggggcgcggtc
ggtggtgtggggatcgcctcggccggtcctatcgacctacacagcggccgcgtcagcccg
atcaacatcggatcctggggcggctttccgctgcgggatcgggtcgccgccgcggtcccg
ggggttccggtgcggctggggggtgacggggtgtgcatggcgctcggcgagcactggctg
ggagccggacggggtgcgcgctttctgttgggtttggtggtgtccaccggggtgggcggc
gggttggtgctcgacggcgccccctgtctcggccgcaccggcaacgccggtcacgtcggc
cacgtggtggtggatccggatggctcgccgtgcccgtgcggggggcgtggctgtgtggag
accatcgcgtccggcccgtcgctggcgcgctgggcgcgggccaacggctggtccgcgccg
cccggggccggcgccaaagagctggccgaggcggctggggccggagacccggtggcgctg
cgggccttccgccgcggcgccgcggcgctggccgcgatgatcgcctcggtgggcgccgtg
tgcgacttggatctcgccgtcatcggcggcggcgtggccaagtcgggtcgcctgctgttc
gagccgttacgtgcggcgctagccgaccacgcccggctggactttctggccggcctgcgg
gtggtgcctgccgagctgggcggcgccgccggcctggtgggtgcggccaggctcgcggcc
atcgcataa

DBGET integrated database retrieval system