KEGG   Mycobacterium bovis AF2122/97: Mb1174cHelp
Entry
Mb1174c           CDS       T00132                                 

Gene name
echA10
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbo  Mycobacterium bovis AF2122/97
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Mb1174c (echA10)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mb1174c (echA10)
   00650 Butanoate metabolism
    Mb1174c (echA10)
  Lipid metabolism
   00071 Fatty acid degradation
    Mb1174c (echA10)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mb1174c (echA10)
   00310 Lysine degradation
    Mb1174c (echA10)
   00360 Phenylalanine metabolism
    Mb1174c (echA10)
   00380 Tryptophan metabolism
    Mb1174c (echA10)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mb1174c (echA10)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mb1174c (echA10)
   00281 Geraniol degradation
    Mb1174c (echA10)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mb1174c (echA10)
   00627 Aminobenzoate degradation
    Mb1174c (echA10)
   00930 Caprolactam degradation
    Mb1174c (echA10)
Enzymes [BR:mbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mb1174c (echA10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1270523..1271329)
Genome map
AA seq 268 aa AA seqDB search
MSNYRIDTRTIVPGLAVTLADGVLSVTIDRPESLNSLTKPVLAGMADAIEGAATDPRVKV
VRLGGAGRGFSSGGAISVDDVWASGPPTDTVAEANRTVRAIVALPQPVVAVVQGPTVGCG
VSLALACDLVLASDNAFFMLAHTNVGLMPDGGASALVQAAIGRIRAMHMALLPDRVPAAE
ALSWGLVSAVYPAADFDAEVDKLISRLLAGPALAIAKTKNAINAATLTELAPTLLRELDG
QALLLRTDDFAEGATAFQQRRTPMFTGR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaactaccggatcgacactcggacaattgtcccgggtctcgccgtcaccctggcc
gacggggtgctgtcggtgaccatcgatcgcccggagagtctcaactcgctgaccaagccg
gtgctggcagggatggccgacgcgatcgagggcgcggccaccgacccacgggtgaaggtg
gtgcgcctcgggggcgccggtcgcggcttcagctccggaggggcaatcagcgttgacgat
gtgtgggccagtggcccgcctaccgacaccgtcgcggaggccaaccgcacggtgcgtgcc
attgtggcactaccacaaccggtcgttgccgtcgtgcagggaccaaccgtcggctgtggc
gtctccctggcgctcgcttgtgacctcgtattggcctccgacaatgcgtttttcatgctc
gctcacaccaacgtggggttgatgcccgacggcggcgcgtcggcgttggttcaggccgcg
atcggccgcatccgcgccatgcatatggcgctgctgccggaccgggtgccggccgccgag
gccttgtcctggggcctggtcagcgccgtctatccggccgccgacttcgatgccgaggtg
gacaagttgatctcacggctgttggccggcccagcgctggctatcgccaagacgaagaac
gcgatcaatgcggccacgctcaccgagttggcacccactctcctgcgcgaattggatggc
caggccctcctcctgcgtactgacgacttcgccgagggcgcaacggcattccagcagcgc
cggacccccatgttcaccggccgttga

DBGET integrated database retrieval system