KEGG   Mycobacterium bovis AF2122/97: Mb1239Help
Entry
Mb1239            CDS       T00132                                 

Gene name
folP2
Definition
dihydropteroate synthase 2 FolP2 (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mbo  Mycobacterium bovis AF2122/97
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mbo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1352438..1353394
Genome map
AA seq 318 aa AA seqDB search
MRSTPPASAGRSTPPALAGHSTPPALAGHSTLCGRPVAGDRALIMAIVNRTPDSFYDKGA
TFSDAAARDAVHRAVADGADVIDVGGVKAGPGERVDVDTEITRLVPFIEWLRGAYPDQLI
SVDTWRAQVAKAACAAGADLINDTWGGVDPAMPEVAAEFGAGLVCAHTGGALPRTRPFRV
SYGTTTRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGKNTFHGLLLLRHVADLV
MTGWPVLMALSNKDVVGETLGVDLTERLEGTLAATALAAAAGARMFRVHEVAATRRVLEM
VASIQGVRPPTRTVRGLA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttcaacaccgccggcctcagccggtcgttcaacaccgccggcgttagccggccat
tcaacaccgccggcgttagccggccattcaacgctgtgcggccgtccagtcgcaggtgat
cgtgcgctgatcatggcgatcgtcaaccgcaccccggattcgttttacgacaagggtgcg
actttcagcgacgcggctgccagagacgcggtccaccgggccgtcgccgacggtgccgac
gtcatcgacgtcggcggtgtcaaagccggcccgggtgaacgcgtcgacgtcgacaccgag
atcacgcggctggtgccgttcatcgaatggctccgcggtgcttacccggaccagctgatc
agtgtcgacacctggcgcgcgcaggtggcgaaggcggcctgcgcggcgggggcggacctg
atcaacgacacctggggtggcgtcgacccggccatgcccgaggtggccgccgagttcggc
gcgggcctggtgtgtgcgcacaccggcggcgcgctgccacgcacgcgacccttccgggtg
agctacggtacgactacccgcggtgtggtggatgctgtgattagccaggtcacagccgcc
gccgagcgggccgtcgcggccggggtggcccgcgagaaggtgttgatcgacccggcacac
gacttcggcaagaacaccttccatgggctgctgctattgcgacacgtggccgatcttgtt
atgaccgggtggcccgtgctgatggctttgagcaacaaggacgttgtcggggagactctg
ggcgtggatttgaccgaacggcttgagggaacgctggcagccaccgcgttggctgcggcc
gccggggcgcgcatgtttcgggtgcatgaggtcgccgccacccggcgggtgctggaaatg
gtggcatcgattcagggggtccggccgccgacgcgcacggtgagaggactcgcatga

DBGET integrated database retrieval system