KEGG   Mycobacterium bovis AF2122/97: Mb1473Help
Entry
Mb1473            CDS       T00132                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbo  Mycobacterium bovis AF2122/97
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mb1473 (tpiA)
   01230 Biosynthesis of amino acids
    Mb1473 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mb1473 (tpiA)
   00051 Fructose and mannose metabolism
    Mb1473 (tpiA)
   00562 Inositol phosphate metabolism
    Mb1473 (tpiA)
Enzymes [BR:mbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mb1473 (tpiA)
Exosome [BR:mbo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mb1473 (tpiA)
  Exosomal proteins of bladder cancer cells
   Mb1473 (tpiA)
  Exosomal proteins of melanoma cells
   Mb1473 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1611892..1612677
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGD
KLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAAT
ALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG
ASLDGEHFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgctgatagccggcaactggaagatgaacctcaaccactacgaggcg
atcgcgctggtgcaaaagatcgcgttctcgttgccggacaagtattacgaccgggttgac
gtcgcggtgatcccgccgtttaccgacctgcgcagcgtgcaaaccctggtcgacggcgac
aagctgcggttgacctatggtgcacaagacttgtcaccacatgactccggtgcctatacg
ggtgacgtcagcggcgcctttctggccaagttggggtgcagttacgttgtcgtcgggcac
tccgagcggcgcacctatcacaacgaggatgacgcgctggtggccgccaaagccgccacc
gcactcaagcatggcttgaccccaatcgtgtgtattggcgagcacctcgacgtccgcgag
gcgggaaatcatgtggcccacaacatcgaacagttgcgtggatcgctggccgggctattg
gccgagcagatcggcagcgtcgtcatcgcctacgaaccggtctgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgtgcggcgatccgaaaagagttggcc
tcgttggcctcgccgaggattgccgatacggtgcgggtgctctacggcggctcggtgaac
gccaaaaacgtcggcgacatcgtggcccaggatgacgtcgatggtggcctggtcggcggg
gcgtcgctggacggggagcatttcgcgacgctggccgcgattgcggccggtggtccgttg
ccgtag

DBGET integrated database retrieval system