KEGG   Mycobacterium bovis AF2122/97: Mb2855Help
Entry
Mb2855            CDS       T00132                                 

Gene name
echA16
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbo  Mycobacterium bovis AF2122/97
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Mb2855 (echA16)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mb2855 (echA16)
   00650 Butanoate metabolism
    Mb2855 (echA16)
  Lipid metabolism
   00071 Fatty acid degradation
    Mb2855 (echA16)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mb2855 (echA16)
   00310 Lysine degradation
    Mb2855 (echA16)
   00360 Phenylalanine metabolism
    Mb2855 (echA16)
   00380 Tryptophan metabolism
    Mb2855 (echA16)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mb2855 (echA16)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mb2855 (echA16)
   00281 Geraniol degradation
    Mb2855 (echA16)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mb2855 (echA16)
   00627 Aminobenzoate degradation
    Mb2855 (echA16)
   00930 Caprolactam degradation
    Mb2855 (echA16)
Enzymes [BR:mbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mb2855 (echA16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3093842..3094591
Genome map
AA seq 249 aa AA seqDB search
MTDDILLIDTDERVRTLTLNRPQSRNALSAALRDRFFAALADAEADDDIDVVILTGADPV
FCAGLDLKELAGQTALPDISPRWPAMTKPVIGAINGAAVTGGLELALYCDILIASEHARF
ADTHARVGLLPTWGLSVRLPQKVGIGLARRMSLTGDYLSATDALRAGLVTEVVAHDQLLP
TARRVAASIVGNNQNAVRALLASYHRIDESQTAAGLWLEACAAKQFCTSGDTIAANREAV
LQRGRAQVR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacatcctgctgatcgacaccgacgaacgggtgcgaaccctcaccctcaac
cggccgcagtcccgcaacgcgctctcggcggcgctacgggatcggtttttcgcggcgttg
gccgacgccgaggccgacgacgacatcgacgtcgtcatcctcaccggcgccgatccggtg
ttctgcgccggactggacctcaaggagctggccgggcagaccgcgctgccggacatctca
ccgcggtggccggccatgaccaagccggtgatcggcgcgatcaacggcgccgcggtcacc
ggcgggctcgaactggcgctgtactgcgacatcctgatcgcctccgagcacgcccgcttc
gccgacacccacgcccgggtgggcctgctgcccacctggggactcagcgtgcgcttgccg
caaaaggtcggcatcggcctggcccggcggatgagcctgaccggcgactacctgtccgcg
accgacgcgttgcgggccggcctggtcaccgaggtggtggcccacgaccagctgctgccc
accgcccgccgggtggcggcgtcgatcgtcggcaacaaccagaacgcggtgcgggcattg
ctggcgtcctaccaccgcatcgacgagtctcagaccgccgccgggctgtggctggaagcc
tgcgcggccaagcaattttgcactagcggcgataccatcgccgccaaccgcgaagccgtg
ctgcagcgcggccgcgcgcaggtgcgttag

DBGET integrated database retrieval system