KEGG   Mycobacterium bovis AF2122/97: Mb3057Help
Entry
Mb3057            CDS       T00132                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mbo  Mycobacterium bovis AF2122/97
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mbo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mb3057
Enzymes [BR:mbo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mb3057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3346482..3348062
Genome map
AA seq 526 aa AA seqDB search
MNTSASPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQVLAALADENRH
RLITLGMTPVVNAQLDDPYCLNGVHHWLANWQLRAEEAASVRYARQSKSADYPSCTPEAL
RAFGIRECADAARALDNFATRWRHGGSPLLRGLIDAGTVELLGGPLAHPFQPLLAPRLRE
FALREGLADAQLRLAHRPKGIWAPECAYAPGMEVDYATAGVSHFMVDGPSLHGDTALGRP
VGKTDVVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGRNVPSEQKA
PYDPERADRAVDVHVADFVDVVRNRLLSESERIGRPAHVIAAFDTELFGHWWYEGPTWLQ
RVLRALPAAGVRVGTLSDAIADGFVGDPVELPPSSWGSGKDWQVWSGAKVADLVQLNSEV
VDTALTTIDKALAQTASLDGPLPRDHVADQILRETLLTVSSDWPFMVSKDSAADYARYRA
HLHAHATREIAGALAAGRRDTARRLAEGWNRADGLFGALDARRLPK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacgtccgcaagcccggtgcccggcctgttcacgcttgttctgcacactcacctg
ccctggctggcccaccacgggcgctggccggtcggcgaggaatggctctatcagtcgtgg
gcggcggcctacctgccgctgctgcaggtgctggccgcgctggccgacgagaaccggcac
cggttgatcaccctcgggatgacgccggtggtcaacgcccagctcgacgacccatactgc
ctcaacggtgtgcatcactggctagccaactggcagctgcgcgccgaagaggccgccagc
gtgcggtatgcccgtcagtcgaagtcggctgactatccgtcatgcacaccggaggcgttg
cgggcctttgggattcgcgaatgtgccgatgcagctcgcgcgctcgacaacttcgccacg
cggtggcggcacggcggcagcccactgctgcgcggcctgatcgacgccggcacggtggag
ctgctcggtggcccacttgcccacccgttccagccgctgctggcaccgcggctgcgcgag
ttcgcgctgcgcgaaggcctcgccgatgctcagctgcggctggcgcaccgcccgaaaggg
atctgggcacccgaatgcgcatacgccccggggatggaggtcgactacgccaccgcgggg
gtcagtcacttcatggtcgacggcccgtcgctgcacggcgacaccgcgctgggccggccg
gtggggaaaaccgatgtggtcgccttcggtcgcgacttgcaggtcagctaccgggtgtgg
tcaccgaaatccggctaccccgggcacgccgcctaccgcgacttccacacctacgaccac
ctgaccggactcaaaccggccagggtcaccgggcgtaacgtgccgtcggagcaaaaggca
ccctacgatcccgagcgcgctgaccgcgccgtcgacgtccatgttgccgatttcgtcgac
gtggtgcgcaatcggctgctctccgagtccgagcgcatcggccggcccgcccacgtgatc
gccgccttcgacaccgagttgttcggccactggtggtacgagggcccaacctggctgcaa
cgggtattgcgggctttacccgccgccggtgtccgggtgggcaccctgagcgatgcgatc
gccgacggattcgtcggcgacccggtcgaattgccacccagctcttggggttccggcaag
gactggcaggtgtggagcggtgccaaggtggccgatctggtccagctcaacagcgaagtg
gtcgataccgcgttgaccaccatcgacaaggcgctggcccagacagcgtccctggacgga
ccgctgcctcgcgatcacgttgctgatcagatcctgcgcgagaccctgctcaccgtgtcc
agcgactggccgttcatggtgagcaaggactccgccgccgactacgcccgctatcgtgct
cacctgcacgcacacgccacccgggagatcgccggcgcgctggccgcgggccgacgcgac
accgcacggcggctcgccgaagggtggaaccgcgccgacggtctgttcggcgccctggac
gctcggaggctgcccaagtga

DBGET integrated database retrieval system