KEGG   Mycobacterium bovis AF2122/97: Mb3722cHelp
Entry
Mb3722c           CDS       T00132                                 

Gene name
glpKa
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mbo  Mycobacterium bovis AF2122/97
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mb3722c (glpKa)
Enzymes [BR:mbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mb3722c (glpKa)
Exosome [BR:mbo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mb3722c (glpKa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(4076348..4077103)
Genome map
AA seq 251 aa AA seqDB search
MSDAILGEQLAESSDFIAAIDQGTTSTRCMIFDHHGAEVARHQLEHEQILPRAGWVEHNP
VEIWERTASVLISVLNATNLSPKDIAALGITNQRETTLVWNRHTGRPYYNAIVWQDTRTD
RIASALDRDGRGNLIRRKAGLPPATYFSGGKLQWILENVDGVRAAAENGDALFGTPDTWV
LWNLTGGPRGGCACHRCNQRQPDHVDGSRDAGLGRRAVVVVFDTSGHAARDRIVGAVGAL
RCHAGDRACRR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacgccatcctaggagagcaattggccgagtcctcggatttcatagccgccatc
gaccagggcaccaccagcacccgctgcatgatcttcgatcaccacggtgccgaggtggcc
cgccaccagctcgagcacgagcagatcctgccccgggccggctgggtggagcacaacccg
gtcgagatctgggagcgcaccgcgtcggtgttgatctcggtgctcaacgccaccaaccta
tcgccgaaagatattgccgcgttggggattaccaaccaacgtgagacgacgctggtatgg
aatcggcacaccggacggccctactacaacgcgattgtatggcaggatacccgcaccgac
cgcatcgcgtcggcgctggatcgagacggtcgtggaaacctgatccgccgcaaggcgggc
ctgccgccggcaacttatttctctggcggcaagctgcagtggatcctggaaaatgtcgat
ggagtccgcgcggccgccgagaacggcgacgcattgttcggcacaccggacacctgggtg
ttgtggaatctgaccggcgggccgcggggggggtgtgcatgtcaccgatgtaaccaacgc
cagccggaccatgttgatggatctagagacgctggactgggacgacgagctgttgtcgtt
gttttcgatacctcgggccatgctgcccgagatcgcatcgtcggcgccgtcggagcctta
cggtgtcacgctggcgaccgggcctgtcggcggtga

DBGET integrated database retrieval system