KEGG   Mycobacterium bovis AF2122/97: Mb3800Help
Entry
Mb3800            CDS       T00132                                 

Gene name
hisC2
Definition
aminotransferase (EC:2.6.1.9)
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mbo  Mycobacterium bovis AF2122/97
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mb3800 (hisC2)
  Amino acid metabolism
   00340 Histidine metabolism
    Mb3800 (hisC2)
   00350 Tyrosine metabolism
    Mb3800 (hisC2)
   00360 Phenylalanine metabolism
    Mb3800 (hisC2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mb3800 (hisC2)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Mb3800 (hisC2)
Enzymes [BR:mbo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     Mb3800 (hisC2)
Amino acid related enzymes [BR:mbo01007]
 Aminotransferase (transaminase)
  Class II
   Mb3800 (hisC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
4153428..4154489
Genome map
AA seq 353 aa AA seqDB search
MTARLRPELAGLPVYVPGKTVPGAIKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCV
QLKAALARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVA
GAIPIQVPLTDHTFDLYAMLAAVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHIL
IAIDEAYVEYIRDGMRPDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALD
KVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVW
LPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAFLRFARRWRSDQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccgcctgcgacccgagctggctgggctgccggtttatgtgcccggcaaaacg
gtgccgggcgccatcaagctggccagcaacgaaaccgtgttcggcccgctgcccagcgtc
cgtgccgccatcgaccgggctaccgacacggtcaaccgctaccccgacaacggctgcgtg
cagctcaaggccgcgctggcccggcatcttggcccggacttcgctcccgagcacgtcgcc
gtcggttgcggctcggtcagcctctgccagcaactcgttcaggtcaccgcctcggttggt
gacgaagtggtcttcggctggcgcagctttgagctctatccaccacaggtccgggtcgcc
ggcgctatccccatccaggtgccgttgaccgaccacacgttcgacctctacgccatgctc
gccgcggtcaccgaccgcacccggctgatcttcgtgtgcaaccccaacaatccgacctcc
accgtcgtcggtccggacgcgctggcccgcttcgtcgaggcggttccggcgcacatcctg
atcgccatcgacgaggcgtatgtggagtacatccgggacggcatgcggcccgacagctta
ggcctggttcgcgcacacaacaatgtcgttgtgctgcgtacgttttcgaaagcgtacggc
ctggcggggttgcggatcggctacgcgatcggccaccccgacgtcataaccgcgctggac
aaggtctacgtgccatttaccgtgtcgagtatcgggcaggccgcggccatcgcgtccctg
gacgccgccgacgagctgctggcccgtaccgacaccgtggttgccgagcgcgcccgcgtc
agcgccgagttgcgtgctgccgggttcacgctgccgccatcgcaggccaactttgtctgg
cttccgctgggatcccgcacccaagacttcgtggagcaggccgccgatgcacgcatcgtg
gtccgcccgtacggcacggatggcgttcgggtcaccgtcgccgcaccagaggagaacgac
gcgttcctgcggttcgcccgccgctggcggagcgaccaatga

DBGET integrated database retrieval system