KEGG   Mycobacterium bovis AF2122/97: Mb3800Help
Entry
Mb3800            CDS       T00132                                 

Gene name
hisC2
Definition
aminotransferase (EC:2.6.1.9)
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mbo  Mycobacterium bovis AF2122/97
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbo01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mbo00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mbo00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:mbo00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mbo00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:mbo00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
4153428..4154489
Genome map
AA seq 353 aa AA seqDB search
MTARLRPELAGLPVYVPGKTVPGAIKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCV
QLKAALARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVA
GAIPIQVPLTDHTFDLYAMLAAVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHIL
IAIDEAYVEYIRDGMRPDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALD
KVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVW
LPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAFLRFARRWRSDQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccgcctgcgacccgagctggctgggctgccggtttatgtgcccggcaaaacg
gtgccgggcgccatcaagctggccagcaacgaaaccgtgttcggcccgctgcccagcgtc
cgtgccgccatcgaccgggctaccgacacggtcaaccgctaccccgacaacggctgcgtg
cagctcaaggccgcgctggcccggcatcttggcccggacttcgctcccgagcacgtcgcc
gtcggttgcggctcggtcagcctctgccagcaactcgttcaggtcaccgcctcggttggt
gacgaagtggtcttcggctggcgcagctttgagctctatccaccacaggtccgggtcgcc
ggcgctatccccatccaggtgccgttgaccgaccacacgttcgacctctacgccatgctc
gccgcggtcaccgaccgcacccggctgatcttcgtgtgcaaccccaacaatccgacctcc
accgtcgtcggtccggacgcgctggcccgcttcgtcgaggcggttccggcgcacatcctg
atcgccatcgacgaggcgtatgtggagtacatccgggacggcatgcggcccgacagctta
ggcctggttcgcgcacacaacaatgtcgttgtgctgcgtacgttttcgaaagcgtacggc
ctggcggggttgcggatcggctacgcgatcggccaccccgacgtcataaccgcgctggac
aaggtctacgtgccatttaccgtgtcgagtatcgggcaggccgcggccatcgcgtccctg
gacgccgccgacgagctgctggcccgtaccgacaccgtggttgccgagcgcgcccgcgtc
agcgccgagttgcgtgctgccgggttcacgctgccgccatcgcaggccaactttgtctgg
cttccgctgggatcccgcacccaagacttcgtggagcaggccgccgatgcacgcatcgtg
gtccgcccgtacggcacggatggcgttcgggtcaccgtcgccgcaccagaggagaacgac
gcgttcctgcggttcgcccgccgctggcggagcgaccaatga

DBGET integrated database retrieval system