KEGG   Monosiga brevicollis: MONBRDRAFT_10860Help
Entry
MONBRDRAFT_10860  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MONBRDRAFT_10860
Peptidases [BR:mbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MONBRDRAFT_10860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1086 aa AA seqDB search
MVVAEQSGRRVPFPAAATATSTTSTTSSVTTAVVGKSGCTATGEGTAWRRRSSGGREAGS
FGSQVGAEAPLWRRSGAGLEHNKPRRRHRRSRRGAQHASSSTAPATVAIKASDIDAAAAS
PTITAAAACSPGLSGSYSQALQRAQPRFYVAASSPLSCSTSAMNTGLPQDDGAEPAAPTQ
AQQQRLYDEAFIKKDDWKTGMECVLLPFVWHRALTEFLAGKTSMPPASPIPMSSLMDAKT
RKLQAQAFAAEVNLEAFSLLRSWYGVDDPAAIFVCPVYLDANNRPKVETHPLKFRVAAVT
DNDNIQSKLQDLSISRLKTVTDLKAAILDQFDVPGTVEARLWEYQARQCSSSGQTVAAVP
SYNSSGGISSTSYANGTGSGYGPGSTLTNRSYGYSSNYGTSTYGGSYGRASNKPILPGRT
GLRNLGNTCFMNSALQCLSHCADLRQFFLSGRWQQDLNKNNPIGCDGHLAEAYAELLEKL
WSATQADVSPWHLKDTISKFAPQFSGYQQHDSQELTAFLLDGLHEDLNRIQKKPFVEAKE
AEGEDVTAAREAWTRHLLRNDSIIVDLFQGQIKSTLNCPECNKISVTFDPMMYLSVPIPE
LDTTFFTITVVFADPRRAPAKCTVELPAKSGTMREMIAAVAEETAVEPRSLVATDLYHSR
FYKIFDGHDTMGNITNGDDVAIFEVPPLEGASWSDEVIPVYHMRQGRAFTSSYYSTSYAA
AMETTGFPFLIRPGPDTTGRQLLAAIADKASQYYAPSHPESSDEEDASEGQNEDAPSMDT
REDAEDSDDEFDRELQANVQAANAPAQGNETSKVVEKAAAPFKSQPPRPAVTELFEVYSS
ESRTSTYSRLGPSLDLDTDEPVDIKRHVIQLYWEREDAENLLSTEAVLTQAESAPSHVSY
TAARKNKHNNVDERDAASVSLRECVERYIQKERLTADNTCFYRDKIDTLVEFPLEGLDMS
PYVLSPKHREGAIYDCFAVSNHSGGYGGGHLLTDAGYWMRHYIDTAYALDESGAWCDYDD
AWVTPMRTNQIVTTESYMLFYRRRKTLSCHAVTGQPLTVPGTPAKVEEADDDMDEAGDDL
STDNLV
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atggttgtggcggaacagtccgggcgcagagtgccttttccagccgctgcgaccgcgacc
tcgaccacgtccacgacaagttcagtgacgactgctgtggttgggaagagcgggtgtaca
gcaactggagagggtactgcgtggcggcgacgatccagtggtggtcgagaggcggggtcg
tttggttcccaggtgggcgcagaggcgcccttgtggagacgcagtggggccggcttggag
cacaacaagcctcgacgacgacaccggagaagtcgacgcggtgcccagcacgcttcatca
tcgacagctcctgctaccgtggccatcaaagcatccgacatcgacgccgctgctgcttct
cccaccattactgctgctgctgcttgctcccccggcctttcgggctcgtacagccaagcg
ctgcaacgcgctcagcctcgattctacgttgctgccagctctcctctgtcttgcagcacc
agtgccatgaacaccggactaccccaggatgatggcgccgaacctgctgctcccacccag
gctcagcagcaacgtctctatgacgaggccttcatcaagaaggacgactggaagactggc
atggaatgcgtactgctcccctttgtctggcatcgggccttgacagagttcctggcgggc
aagacctccatgcctccggcctcccccatccccatgtccagcttgatggatgccaagacc
aggaagctacaggcacaggccttcgccgccgaggtcaacctggaggccttttcgctcctg
cgctcctggtacggtgtggacgatccagccgccatttttgtttgccccgtctatctcgac
gcaaacaaccgtcccaaggtggaaacccaccccctgaaatttcgagtggcggccgttaca
gataatgacaacatccagtcaaaattgcaggatctcagcatttcgcgcctcaagacggta
accgacctcaaggcagccatcctcgatcagtttgatgttccaggcaccgtcgaagcacgc
ttgtgggagtatcaggcccgccaatgctcttcctctggccagacggtcgccgcagttccc
agctacaattccagtggtggcattagcagcacctcatatgccaatggcaccggctctggt
tacggtccgggcagtaccctcacgaaccgctcctacggttattcctccaactacggcacc
tccacttatggtggttcatatggccgcgcctcgaacaagcccatcctgcctggacgcacg
ggcctccgcaatctgggcaacacatgtttcatgaactcggccttgcagtgcctcagccat
tgtgcagacctgcgtcagttctttctctccgggcgctggcaacaggacttgaacaagaac
aatccgattggctgcgatgggcacctggccgaagcttatgccgagctactcgaaaagctg
tggtccgccacacaggcggatgtttcgccgtggcatctcaaggataccatcagcaagttt
gctccacagttcagcggatatcaacagcacgactcccaggagctgaccgccttcctgctc
gacggccttcacgaggatctgaatcgcattcaaaagaaaccctttgttgaagcgaaggag
gccgagggtgaggatgtgactgcagcacgcgaagcttggacacggcacttgctgcgcaac
gactcaatcattgtagatttgttccaagggcaaatcaagtccaccctcaactgcccagag
tgcaacaagatctccgtcacctttgatcccatgatgtacctttccgtgcccattccagaa
ttggacacgaccttcttcactatcaccgtcgtgtttgcggaccctcggcgcgccccagcc
aagtgcaccgtcgagctgccagcaaaatcgggcactatgcgagaaatgattgccgccgtg
gctgaggaaaccgcagtcgagcctcgctcgctcgtggccacagacctgtatcattcgcgc
ttctacaaaatttttgacggacacgacaccatgggcaacattaccaacggcgatgacgtt
gcgatttttgaggtgccgccgcttgagggcgcctcttggagtgatgaggtcattcccgtg
taccacatgcgccagggccgcgcctttaccagctcgtactatagcacgtcgtatgccgcg
gccatggagaccacgggtttcccctttttgattcgcccgggccccgacacaacgggtcgt
cagctgttggcagccatagctgacaaagcctcgcaatattatgctccatctcatccagag
tcgtccgacgaggaggacgcgagcgagggccagaacgaggacgcgcccagtatggatacc
agggaagatgccgaggacagcgatgacgaattcgatcgcgagcttcaagccaacgttcaa
gccgccaacgctcctgctcaaggcaatgagacctcgaaagttgttgagaaagcggccgca
cccttcaagtcacagccaccccggccggccgtcaccgaattgtttgaggtgtacagctcg
gaatcacgcaccagcacatactcgcggctgggcccgagtttggacttggacacggatgag
cccgtcgacattaaacgtcacgtcattcagctttattgggagcgagaagatgcggagaac
ttgctgtcaaccgaagctgtcttgacccaggccgagtccgcgccaagccacgtgtcctat
acagcagcgcgaaagaacaaacacaacaacgtggatgagcgagatgccgcgtccgtgtcc
ttgcgcgagtgcgttgagcgttacattcaaaaagaacgcttgacggctgacaacacgtgc
ttttatcgtgacaagattgatacgcttgtggagtttccgctggaggggctggatatgtct
ccgtatgtgctctcgcccaagcaccgtgagggagccatctacgactgttttgccgtgtcc
aaccactctggtggctacggtggtggtcatttgctcactgacgcggggtattggatgcgg
cactatatagatacggcatatgccctggatgagtcgggcgcgtggtgtgattatgacgat
gcctgggtcacgcccatgcgcaccaaccagattgtgacgacggagagctacatgttgttc
tatcgacgacgcaagacgctctcttgccacgctgtaaccgggcagcctttgacggtgcct
ggcacgccagccaaggtggaggaagctgacgatgacatggacgaagcgggcgacgacttg
agcacggataatcttgtgtga

DBGET integrated database retrieval system