KEGG   Monosiga brevicollis: MONBRDRAFT_11214Help
Entry
MONBRDRAFT_11214  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mbr  Monosiga brevicollis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MONBRDRAFT_11214
Enzymes [BR:mbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MONBRDRAFT_11214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 644 aa AA seqDB search
MVIPWGRPGLDGVLLKHACLVSAVIVPFGLVLAKLRERAKAYQLELLARAEEPEPVPVPV
PAGHDSATRAHGPRIVILGGGISGLSAAFLLKARQPDAHVTILEASSRLGGNMHTHALQL
PDKDGSAHHIELGPRSLRTTTPAAKAALQMMLALGLGDKLTFAERTTRGRRYVYNFDRRG
LLELPSSFLAFLKFAFEYNLPLCLARDVAHFGASLWAALCNRSNHTARVRALNDMTVDSF
FRTHFSDRIAAELGSALVRGIFSGSSTNLLLKHAFPSLWQLVAAYDSVVVGALLNPFLHL
SDHFALQPELHIPTAGVDPTTASELLARARRERVASVQGGLSTIIDTLADRLRAQGVVIR
TNVVAHALLSSMDNPNQAAVLCASAHEPAGPWEQLDATDIIATLPPPALASLIEQTLELD
TQPSSQAPRPTRTLPDGFEPAFTAPRLAWRARGAATALRRMPSLSLATVTLVYQNQSFGN
LVHRADAQPGFGMLIPEGGLGHPKPTLGVVYDSLVFPELAGRQHTVLTCMFGGADPAAQA
RVTGMPSSELADVAQQEVNRLLGVKAVPSLCVPTLWRDAIPQFTKAYDRARAQVEEDFLG
PHLPWLQITGKAFGTGVGVNDCIYSAMRTAEQTLARWHDRAAHA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggtgataccatgggggcgtccaggtctcgatggggttctcctcaaacacgcctgcctg
gtttctgcggtgattgtgccgtttggcttggtgctggcaaagctcagggagcgtgccaaa
gcctatcaactggaactcctcgctcgggccgaagagccggagcccgtgcccgtgcccgtg
cccgctgggcatgactcggccaccagggcccatggacctcgcatcgtcattctgggtggg
ggcatctcgggcttgagcgcagcctttctgctcaaggcccgccaacccgatgcacacgtg
actattctcgaggcctccagccgcttgggcggaaacatgcacacccatgccctgcagctg
cccgacaaggatgggagcgcacaccacattgagctgggcccccgatcccttcgcaccacc
acccccgccgccaaagccgccctccagatgatgctggcgctcggcctcggcgacaagttg
acgtttgctgagcgaacgacgcgaggacgccgctacgtgtacaactttgaccgtcgtggg
ctgctcgaactgccctcctccttccttgcctttttgaagtttgcctttgagtacaacctc
cctctttgtctggcccgcgatgtggctcactttggtgccagtctctgggccgccctgtgc
aatcgatccaaccacaccgcccgcgtacgcgcactcaacgacatgaccgtggacagcttc
tttcgtacacacttttctgaccgcattgccgccgagctgggatcggcactggtacgcggc
attttcagcggctcctcgaccaacctactgctcaagcatgcctttcccagcctatggcaa
ctcgtggccgcctacgactcggttgtggtcggcgctctgctcaacccctttctccatctc
agcgaccactttgcccttcagcccgagctacacatccccaccgctggcgtcgaccccacc
accgctagcgagcttctagcccgggcgcgccgcgagcgcgttgcctccgtccagggcggc
ctctccaccatcattgacactttggccgaccgcctccgagcgcagggcgttgtcattcgc
accaatgtcgtggcccatgccctgctcagctccatggacaaccccaatcaggcggccgtg
ctttgtgcttcagcccacgagcctgcgggtccctgggaacagctcgacgccaccgacatt
attgccaccctgcccccaccagctctcgcatccctgatcgagcaaacgctcgagctggac
acccagcccagcagccaggccccacgcccaacccgaacccttcccgacggattcgagcct
gctttcacggcaccccgtttggcatggcgtgcgcgcggcgccgcgactgctctccgccgc
atgccctcgctctccctggccactgtgacgctggtgtaccagaaccaaagttttggaaac
ctggtacatcgcgcagacgctcaaccgggctttggcatgctcataccagagggtggtctg
ggtcatcccaagccaaccttgggggtggtctacgactcgctcgtgtttccagagctggcc
gggcgtcaacacacggtcctcacgtgcatgtttggtggtgctgaccctgcagcccaagcc
cgggtgaccggcatgccgtccagcgagctggccgatgtggcgcagcaagaagtcaaccga
ttgctgggcgtcaaggccgtgcccagcctctgtgtgccaacgctttggcgcgatgccatt
ccccagttcaccaaagcctatgatcgggcgcgggctcaagtggaagaagactttttgggg
ccccatctgccctggcttcagattactggcaaagcctttggcacgggcgtcggcgtgaat
gattgtatttatagcgccatgcgcacggccgagcagactcttgctcggtggcatgaccgg
gcagcccatgcctga

DBGET integrated database retrieval system