KEGG   Monosiga brevicollis: MONBRDRAFT_11214Help
Entry
MONBRDRAFT_11214  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mbr  Monosiga brevicollis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mbr00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 644 aa AA seqDB search
MVIPWGRPGLDGVLLKHACLVSAVIVPFGLVLAKLRERAKAYQLELLARAEEPEPVPVPV
PAGHDSATRAHGPRIVILGGGISGLSAAFLLKARQPDAHVTILEASSRLGGNMHTHALQL
PDKDGSAHHIELGPRSLRTTTPAAKAALQMMLALGLGDKLTFAERTTRGRRYVYNFDRRG
LLELPSSFLAFLKFAFEYNLPLCLARDVAHFGASLWAALCNRSNHTARVRALNDMTVDSF
FRTHFSDRIAAELGSALVRGIFSGSSTNLLLKHAFPSLWQLVAAYDSVVVGALLNPFLHL
SDHFALQPELHIPTAGVDPTTASELLARARRERVASVQGGLSTIIDTLADRLRAQGVVIR
TNVVAHALLSSMDNPNQAAVLCASAHEPAGPWEQLDATDIIATLPPPALASLIEQTLELD
TQPSSQAPRPTRTLPDGFEPAFTAPRLAWRARGAATALRRMPSLSLATVTLVYQNQSFGN
LVHRADAQPGFGMLIPEGGLGHPKPTLGVVYDSLVFPELAGRQHTVLTCMFGGADPAAQA
RVTGMPSSELADVAQQEVNRLLGVKAVPSLCVPTLWRDAIPQFTKAYDRARAQVEEDFLG
PHLPWLQITGKAFGTGVGVNDCIYSAMRTAEQTLARWHDRAAHA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggtgataccatgggggcgtccaggtctcgatggggttctcctcaaacacgcctgcctg
gtttctgcggtgattgtgccgtttggcttggtgctggcaaagctcagggagcgtgccaaa
gcctatcaactggaactcctcgctcgggccgaagagccggagcccgtgcccgtgcccgtg
cccgctgggcatgactcggccaccagggcccatggacctcgcatcgtcattctgggtggg
ggcatctcgggcttgagcgcagcctttctgctcaaggcccgccaacccgatgcacacgtg
actattctcgaggcctccagccgcttgggcggaaacatgcacacccatgccctgcagctg
cccgacaaggatgggagcgcacaccacattgagctgggcccccgatcccttcgcaccacc
acccccgccgccaaagccgccctccagatgatgctggcgctcggcctcggcgacaagttg
acgtttgctgagcgaacgacgcgaggacgccgctacgtgtacaactttgaccgtcgtggg
ctgctcgaactgccctcctccttccttgcctttttgaagtttgcctttgagtacaacctc
cctctttgtctggcccgcgatgtggctcactttggtgccagtctctgggccgccctgtgc
aatcgatccaaccacaccgcccgcgtacgcgcactcaacgacatgaccgtggacagcttc
tttcgtacacacttttctgaccgcattgccgccgagctgggatcggcactggtacgcggc
attttcagcggctcctcgaccaacctactgctcaagcatgcctttcccagcctatggcaa
ctcgtggccgcctacgactcggttgtggtcggcgctctgctcaacccctttctccatctc
agcgaccactttgcccttcagcccgagctacacatccccaccgctggcgtcgaccccacc
accgctagcgagcttctagcccgggcgcgccgcgagcgcgttgcctccgtccagggcggc
ctctccaccatcattgacactttggccgaccgcctccgagcgcagggcgttgtcattcgc
accaatgtcgtggcccatgccctgctcagctccatggacaaccccaatcaggcggccgtg
ctttgtgcttcagcccacgagcctgcgggtccctgggaacagctcgacgccaccgacatt
attgccaccctgcccccaccagctctcgcatccctgatcgagcaaacgctcgagctggac
acccagcccagcagccaggccccacgcccaacccgaacccttcccgacggattcgagcct
gctttcacggcaccccgtttggcatggcgtgcgcgcggcgccgcgactgctctccgccgc
atgccctcgctctccctggccactgtgacgctggtgtaccagaaccaaagttttggaaac
ctggtacatcgcgcagacgctcaaccgggctttggcatgctcataccagagggtggtctg
ggtcatcccaagccaaccttgggggtggtctacgactcgctcgtgtttccagagctggcc
gggcgtcaacacacggtcctcacgtgcatgtttggtggtgctgaccctgcagcccaagcc
cgggtgaccggcatgccgtccagcgagctggccgatgtggcgcagcaagaagtcaaccga
ttgctgggcgtcaaggccgtgcccagcctctgtgtgccaacgctttggcgcgatgccatt
ccccagttcaccaaagcctatgatcgggcgcgggctcaagtggaagaagactttttgggg
ccccatctgccctggcttcagattactggcaaagcctttggcacgggcgtcggcgtgaat
gattgtatttatagcgccatgcgcacggccgagcagactcttgctcggtggcatgaccgg
gcagcccatgcctga

DBGET integrated database retrieval system