KEGG   Monosiga brevicollis: MONBRDRAFT_12205Help
Entry
MONBRDRAFT_12205  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mbr  Monosiga brevicollis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:mbr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbr00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mbr00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 220 aa AA seqDB search
MGMCQSAGATAAKKQPGKNQPSVGPTPTLVLLRPGSTAASGEEDPKLDSTGLALAERVGH
AMVHEHADFDVVYCSTRRRDVKTTNVVLEAIDRLFLPVEKEANLVETNTAINEAAGPVWE
LDIRPKLKAGLRVLVVAELPTLACLVSKVDSVPSAVAADLALEPGAAMVYTFDAATMTVQ
QYTEAPKPAGEPHSDATADEPSEATAPSHPFAARIISAPA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgtgccagtcagccggtgccacggccgcgaagaaacaacccggcaagaatcag
cccagtgtaggccccacccccacgctggtgctcctgcgcccaggcagtacggcagcgtcg
ggcgaggaggaccccaagctcgactcgaccggacttgcgctggctgaacgagtgggccat
gccatggtccatgagcacgccgactttgacgtggtctactgctcgacccgtcgccgcgac
gtgaagaccaccaatgtggtgctcgaggccattgaccgcctctttctgcccgtcgaaaag
gaggccaacctcgtcgagacgaacaccgccatcaatgaagctgccggccctgtctgggaa
ctggacattcgccccaagctcaaggccggcctgcgggtgctagtggttgcagagctcccc
acactggcctgtttggtcagcaaggttgatagcgttccctcggccgtggcggccgatctg
gcgctcgagcccggagccgccatggtctacacctttgatgccgccacgatgacggtgcag
caatacaccgaagcaccgaagcctgctggagagccgcacagtgacgccacagcggacgag
ccatctgaagcgaccgccccatcccatccatttgcggcacgcatcatctcggcgcccgcc
tga

DBGET integrated database retrieval system