KEGG   Monosiga brevicollis: MONBRDRAFT_12522Help
Entry
MONBRDRAFT_12522  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mbr  Monosiga brevicollis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mbr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 442 aa AA seqDB search
MRGKGRPWMSTVGFVVMVVVGLLCVGLVPGAAGFYSKKGDVIVLDSPALLDSLEASNYLW
FVELYREGCGYCQQLTPHWTELAGKLKRLVRVAALDVEKNGPLLQTMMQRYDFDVKGVPT
IIMLKPWGKKDGTMSKKRIDYNGERTAQALYKAAVKHMPDYTTFVTAASLDRFTAGDQAK
AVLFTPKAQTPVMWKGLASKYRHRLELGVTLDDDATQLRDLLGLERFPTVRIYTNGSHVD
FTGTTNFLNLDLFLSQHAAAKPSRPTPPNSSSGSSQSTAKDQSDPKNRSKTGAKKSTTKS
KSKASASPARTDLRTLSTKKLNKMKIRELKLILDEYNAPCRGCIEKQHYIDRVLEAKLKV
AQQELKTLRAENEALRKEVEQLKQTGHCHSEDTHEDLYLADEEDGYIELIEDEPDNDDED
DTEETSIQDDDDGEEEQDEDIE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcgggggaaggggcggccgtggatgtcgacggttggatttgtggtgatggtggtggtg
gggttgttgtgtgtgggtttggttcctggggcagcaggcttttacagtaaaaaaggcgat
gtgatcgtgctggattcgccggcgctgttggatagcctcgaggccagcaactacctttgg
tttgtcgaactgtatcgggagggctgcggctactgtcagcagctgacgccccactggacg
gagcttgcaggcaagctcaagcggctggtgcgcgtggccgccctcgacgttgaaaagaat
ggcccgttgttacagaccatgatgcagcggtatgactttgatgtcaagggcgtgcccacc
atcatcatgctcaagccctggggcaagaaagatggcaccatgtcgaaaaagcgtatcgat
tacaacggtgagcgcaccgctcaagccctgtacaaggccgccgtcaagcacatgcccgac
tacaccacctttgtcaccgcagccagccttgaccgcttcacggccggtgaccaggccaag
gctgtgcttttcacgcccaaggcccaaacgcctgtcatgtggaagggcttggccagcaag
tatcgtcaccgcctcgagctgggcgtgacgctcgacgatgatgcaacccagctgcgcgac
ctgctaggccttgagcggtttcccactgttcgcatctatacaaacggctctcatgtcgat
ttcaccggcaccaccaactttctcaacctcgacctcttcctgtcgcagcacgccgctgcc
aagccgagtcgccccaccccgcccaattccagcagcggctcctcacagtccactgccaaa
gaccagtccgaccctaagaaccgatcaaaaaccggggccaagaaaagtacaaccaagagc
aagtccaaagcaagcgcgtcccccgcgcgcaccgaccttcgcactctctcgacaaagaag
cttaacaagatgaaaattcgtgagctcaagttgattctcgacgagtacaacgcaccctgc
cgaggctgcatcgagaaacagcattacattgaccgcgttctcgaggctaagctcaaagtg
gcgcaacaggaactcaagactctgcgtgccgaaaatgaggccttgcgcaaggaagtggag
cagctgaagcaaaccggccactgtcactcggaagacacgcatgaagacttgtacctagct
gatgaggaggacggatacatcgagttgatcgaggatgaaccagacaatgacgatgaggat
gatacagaagagacttcaattcaggatgacgacgatggtgaggaagaacaagatgaggac
attgaatag

DBGET integrated database retrieval system