KEGG   Monosiga brevicollis: MONBRDRAFT_12960Help
Entry
MONBRDRAFT_12960  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 359 aa AA seqDB search
MTPPKGAVAEVGKPSHNVVAGADRHYVQASVLVEVGETLDSYALTRTLGTGSFGRVLLAQ
DKDSSGNPVKDDYKAIKIINKERVIKTRQVEHTINEKNILFTTNCNFVVKLYDYFQDLKC
LYFVLEFVNGGEMFTHIQKQRKRRFTEEQTRFFSAETVLAFEYLHNLDIVFRDLKPENML
IDHRGHIRVTDFGFAKRVDDKTWTMCGTPEYLAPEIIVNKGYGHAVDWWAVGILTYEMRC
GRSPFESRSQMEMFKRITKRDYKFPRDFTEEERSFIDGLLQVDLTRRLGNMHGGVDDIKR
HPYFASLDWDKLYSHAAKSPYVPKVTGPGDCRNFDSYPEEPVRWHGTGADKFGDTFQGF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcccaaaggtgccgttgccgaggttgggaaaccaagccacaacgtcgttgcc
ggagccgaccgccactatgtccaagcgtccgtcctggttgaagtcggcgagacgctcgac
agctatgctttgactcgcacccttggtaccggctcttttggccgcgtccttcttgctcaa
gacaaggattcctcgggcaaccccgtcaaggacgattacaaggccatcaagattatcaac
aaggagcgcgtcatcaagacccgccaggttgagcataccatcaacgagaagaacattttg
ttcaccacaaactgcaactttgtggtcaaactgtacgactactttcaagacctcaagtgc
ctttactttgtcctcgagtttgtcaacggtggtgaaatgttcacgcacattcagaagcag
cgcaagcgccgcttcaccgaggaacaaacccgcttcttctccgcggaaacagtcctggcc
tttgagtacctgcacaacctggacattgtcttccgggacctcaagcccgaaaacatgctc
atcgaccatcgtggccacattcgcgtcacggactttggctttgcaaagcgcgtcgatgac
aagacatggaccatgtgtggaaccccagagtaccttgcacccgaaatcattgtcaacaag
ggttacggccacgccgtcgactggtgggccgtcggcatcctcacctacgagatgcgctgc
ggtcgttctccctttgaatcccgctcgcaaatggaaatgttcaagcgcatcaccaagcgc
gactacaagtttccccgcgactttaccgaggaggagcgctccttcatcgatggcctgctc
caggtcgatctcacccgccgcctcggcaacatgcacggcggcgtggatgacatcaagcgc
catccctactttgcctcgctcgattgggacaagctttactcacacgccgccaagtcaccc
tacgtgcccaaggtcacgggacccggcgattgccgcaactttgacagctaccccgaagag
ccggtccgatggcatggaaccggcgccgacaagtttggcgacaccttccaaggcttttaa

DBGET integrated database retrieval system