KEGG   Monosiga brevicollis: MONBRDRAFT_13263Help
Entry
MONBRDRAFT_13263  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbr  Monosiga brevicollis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MONBRDRAFT_13263
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MONBRDRAFT_13263
   00620 Pyruvate metabolism
    MONBRDRAFT_13263
   00640 Propanoate metabolism
    MONBRDRAFT_13263
Enzymes [BR:mbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MONBRDRAFT_13263
Lipid biosynthesis proteins [BR:mbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MONBRDRAFT_13263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 643 aa AA seqDB search
MAASAHATSTTDDDADYVAYYNDCMQNPNAFWDQQARQRLQWRQLYDKVADHNLAEGQIR
WFTNGKLNVAENCIDRHVESGRGDATALIYEADEPGTTQHITYKELQEQVNRLANVLLQQ
GVKQGDRVCLYLPMTPYAVYAMLACARIGAIHTLVFAGFSEDALAARISDGDCRVLITAD
ESVRGGKKIPLRQIANDALAQIPGQVRAVLVQERTGKTPPQAYDIKLYEAMAAASPVAES
ATVDAEDGLFLLYTSGSTGAPKGLLHTSGGYLLYAGYTHEHFFDYKPGDIYACLADVGWI
TGHTYVVYGPLVNGATTVIFESVPTYPDASRYWEMVERLRINQLYTAPTALRLLMKQGDD
FVQKHDRSSLRVLGSVGEPINPEVWRWFHDVVGNKQCRIADTWWQTETGGIMMCPSPLAS
KEGHKPGAAMHPAVGVVPLLLGTDGQEIKGNDVEGLLCLRDPTPGMARTVFGNHKRFCET
YWSHFPGYYFTGDGAKRDSEGHYHITGRVDDVINVSGHRLGTAEVESSLLLHKGVAESAV
VGYPHDVKGEGICAYVILRADFEPTGNTAKELKEVVRHHIGAFASPDRVQLVKDLPKTRS
GKIMRRILRKIASNQLNELGDLSTLAEPKVVDEIIEGHKEFLG
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggcggcatctgcccatgccacctcgacaaccgacgatgacgccgattacgttgcctac
tacaacgattgtatgcaaaaccccaacgccttttgggatcagcaagcccgacagcgactc
cagtggcgccagttgtatgacaaggtggctgaccacaacttggctgaaggtcaaatccgc
tggtttaccaacggcaagctcaacgttgctgagaactgtatcgaccgccatgtcgagtcg
ggtcgtggagatgcgaccgcactcatctacgaggctgacgagccaggcaccacccaacac
attacttacaaggagcttcaagaacaagtcaaccgtctcgccaacgttctcctgcagcag
ggcgtcaagcagggcgaccgcgtctgcctctacctccctatgaccccctacgcagtgtat
gccatgctagcatgtgcacgcatcggtgccatccacactcttgtctttgcgggctttagc
gaggacgcgcttgctgcccgcatctctgacggtgattgccgtgtcttgatcactgccgac
gaaagtgttcgtggtggcaagaaaattcctctgcgtcaaattgccaacgatgctctcgct
caaatcccgggtcaagtacgagcagtccttgttcaagagcgcaccggtaagaccccgccc
caggcgtatgacatcaagttgtacgaagccatggcagctgcttcacccgttgccgagtcg
gccacagtggacgccgaggatggcctcttcctcctttacacctcgggtagcacaggagca
cccaagggacttttgcacacttcgggtggctacctcctctacgccggctatactcatgag
cactttttcgactacaaaccgggagatatctatgcatgcttggccgacgtcggctggatc
actggccatacctacgtggtctacggccctctcgtcaatggcgctaccacagtcattttc
gagagcgtgccgacttacccagatgcaagccgatattgggagatggttgagcgactgcgc
attaatcagttgtacacggccccaaccgcgctacgccttttaatgaagcaaggcgacgac
tttgtgcagaagcatgaccgctcttcgttgcgcgtcctgggttcggtcggtgagcccatc
aacccagaggtgtggcgctggtttcacgatgtggttggcaacaaacagtgccgaattgcc
gacacctggtggcaaacggagactggtggcatcatgatgtgcccctcaccgttggcaagc
aaggaaggtcataagccgggtgccgccatgcacccagccgttggcgtggtgcccctcttg
ctaggcaccgatggtcaagaaatcaaaggcaacgacgtcgaaggtcttctatgccttcga
gatcccacgccaggaatggcccggacagtctttggaaaccacaaacgattttgtgaaacc
tattggtcgcactttcccggctactactttacgggcgatggagcaaagcgcgattctgaa
ggccattatcacatcacaggccgcgtggacgacgtgatcaatgtcagtggtcaccgcctc
ggtactgccgaggttgagagctcgctcctgctacacaagggcgtcgctgagtcggccgtc
gtgggctatccacacgatgtcaagggtgaaggaatttgtgcctacgtgattttgcgtgcc
gattttgagccgacgggcaacacagccaaggagctcaaggaggttgtgcgccaccacatt
ggcgcctttgccagtcctgatcgcgtgcagttggtcaaggacttgccaaagacgcgttcg
ggcaagatcatgcgtcgcatcttgcgcaaaattgccagcaatcagctgaacgagttggga
gatctttctactctggctgaacccaaagtagtcgacgagatcattgaaggccataaggaa
ttcctgggctga

DBGET integrated database retrieval system