KEGG   Monosiga brevicollis: MONBRDRAFT_14123Help
Entry
MONBRDRAFT_14123  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mbr  Monosiga brevicollis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MONBRDRAFT_14123
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MONBRDRAFT_14123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 310 aa AA seqDB search
MAEAKAEVVVVGSSNTDLIAYMDRMPRPGETLHGTDFKQGFGGKGANQCVMSAKLGAQTA
MVSRVGSDVFGKETIENYQRQGVDVQFVSVSETASTGVAPIMVDSKGQNSIIIVPGANNE
LTPAMVDDARALIQSAKVLLVQNEIPLESSLAALRIAREAGVTSIFNIAPGIERPSTDCI
VLPSIVCLNETETTLATGMEVNTLEEAKQASQHLLNTGAEGVLLTLGSQGCLYMTKDTCV
QEPAMTVEAIDTSGAGDCFIGTLACSMAQEPAADMATHLKRATRVAALSVQAHGTQTSYP
RRADLPSDTW
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcaaaggcagaggtggtggtagtgggctcgtccaacacagacttgattgca
tatatggatcgtatgcctcgtcccggtgagaccctgcatggaaccgactttaagcagggt
tttggtgggaagggggccaaccagtgcgtcatgagcgccaaactgggcgcccaaacggct
atggtgtcccgggtgggcagtgatgtctttggcaaggagacaatcgagaactaccagcgt
cagggcgtggacgtacaatttgtctccgtctccgagacggcctcgaccggggtggccccg
atcatggtggacagcaaaggccaaaatagcatcatcattgtacctggtgccaacaatgaa
ctaacgcctgccatggtggacgatgcgcgggccctcatccagtcagccaaggtcttgctg
gtccagaacgagattcctctcgagtcttcgctggcggcgttgcggattgcacgcgaggct
ggcgtgacaagcattttcaacattgcaccgggcattgagcgtcccagcacggattgcatt
gtcttgccctccattgtttgtctcaatgagaccgaaacgactttagcaacgggcatggaa
gtcaacacgcttgaggaagccaagcaagcatcacagcatcttctgaacacgggtgcggaa
ggggttttgttgacgctgggctcccaggggtgcctgtacatgacaaaggacacgtgtgta
caagagccggccatgaccgtggaggccatcgacacctccggggcgggtgactgttttata
ggcacgctggcctgcagcatggcgcaagagccagcggccgacatggccacccacctcaag
cgagccactcgcgtcgccgccctatctgtccaggcgcatggtacacaaactagctaccca
cgacgcgccgacctaccaagcgacacctggtag

DBGET integrated database retrieval system