KEGG   Monosiga brevicollis: MONBRDRAFT_14245Help
Entry
MONBRDRAFT_14245  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MONBRDRAFT_14245
Transcription machinery [BR:mbr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MONBRDRAFT_14245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 321 aa AA seqDB search
MRPPCRARNLFSRSLRNMPKDYIARIVFDIRHRTLYLSRQDQVVAGINFRCFPEHAIVEI
VFVAVDSSEQVKGFGTYLMNHMKAYALKLHCTALVTFADDSAVGYFSKQGFTQHLTLAPK
RLAVAKLYTGGVLMQCELHPAIPYLNLSQMISRQQQVRLHAWLNLPPMRHLSISRAREHI
AHAFVRGEGFVAVKDIPGVLEAGWSDAMLLQSKPKAKPAQKRKEQHSKSKRGGPVIRDLR
NHSQSWPFREPVDPTVYPEYYETIAYPMDLKTIAAKFKAKEYLTKDDFVNDCNLMLDNCV
NYNPPDSDYYRCAELLRVFLQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcggccaccttgtagggctcgcaacctcttctcccgttcgttgcgcaacatgcccaag
gattacattgcacgcatcgtgtttgatatccgccaccgcacgctctatctctcccgtcaa
gaccaggtggttgcgggaatcaattttcgctgtttcccagaacacgcgattgttgaaatt
gtctttgttgccgtcgactcttcggagcaagtcaagggctttggcacttacttgatgaat
catatgaaagcgtatgcgctgaagctgcattgcactgctttggtgacgtttgccgatgac
tcggcagtcggatactttagcaaacagggctttacccaacacctcaccctcgcaccaaag
cgccttgccgtggccaagctctacacgggtggcgtcctcatgcagtgtgaactgcaccct
gcgatcccctacctgaatctgagtcaaatgatcagtcgtcaacagcaggtgaggctgcac
gcctggctcaacctgccacccatgaggcatctctcgatctctcgagcgcgcgaacatatc
gctcacgcctttgtcaggggcgagggctttgtcgccgtcaaggacattcctggcgttctt
gaagccggctggtctgatgccatgctgctccaatccaagccaaaggcgaagcccgctcag
aaacgcaaagagcaacacagcaagagcaagcgcggcggaccagtaattcgagatttgcgt
aaccactcgcaatcatggccttttcgagagccagtcgacccaacggtctaccccgagtat
tacgagaccattgcgtatcccatggatctcaaaaccattgccgctaaattcaaggccaag
gagtacttgaccaaggatgattttgtaaatgattgcaacctcatgctcgacaattgcgtc
aactacaacccccccgactcggattactaccgctgtgcggagcttcttcgtgtgttctta
cagtag

DBGET integrated database retrieval system