KEGG   Monosiga brevicollis: MONBRDRAFT_14402Help
Entry
MONBRDRAFT_14402  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K03099  
son of sevenless
Organism
mbr  Monosiga brevicollis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 436 aa AA seqDB search
MDRVEFSLFHPPSRREYRFATPDSEANILFDEKESEARGFRVVKAGTLEKLVELLTHPQH
TDTEYLRHFLTTYRSFCDSERLLELLLERYDVPDAEAVRHDAKQARFFHKQYRSPVRLRV
INVLKQWVEKHFYDFQAPQARPSDPVVVSRQEMRRRWYVSARTGHNRHGSAGTSPWHRAH
GRHSRSFRHLLNFHPQEVARQMTIIEFHLYKRIWPSELVGLMWTRRDKWQHAPNVLNMTV
RSTLVTRWLTRCIVETANLNERVDLISMIVEILKELRSLNNFNGMMEVVSALNSAAVRRL
NHAWAEVNPRRRALFDECVEQLMGGTNYSRLRQAIEHAPAPKIPFFGMYLTDMTFIEEGS
SDTIPSPLGGVPLINFSKRRLLARTTGTIQQYQNQQYVLAEWPLLQVGVVSPAVCFLLWL
SPGPWRTCFPSRRLPP
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggaccgagtagagttctcactcttccatccaccatcgcgcagagagtatcgattcgcc
actcccgatagcgaggccaacatattgtttgatgagaaggagtcggaagcgcgtggcttt
cgcgtcgtcaaggctggaacattggaaaagctggtcgagttgctgactcatcctcaacac
accgacaccgagtatctgcgccactttctgacgacctaccgttccttctgtgattccgag
cggctactggagctcctgttggagcgctacgatgtgccagatgctgaagcagtgcgccac
gatgccaagcaggctcgtttttttcacaaacagtaccgaagcccagtgcgtctgcgtgtg
atcaacgttctcaagcaatgggtcgagaagcatttttatgattttcaagcgcctcaggcc
cggcccagtgatccggtggttgtgtcgcgtcaggaaatgagaaggagatggtacgtcagc
gcgcgcacgggacacaaccggcatggatctgccggcacaagtccctggcatcgggcgcac
ggcaggcactctcgctcatttcgtcacttgctcaattttcatccgcaagaggtcgcgcgc
cagatgaccatcatcgagtttcacttgtacaagcgcatctggccatcggagctggtcggc
ctgatgtggacccggcgtgacaagtggcaacatgcaccaaatgtgctgaacatgaccgtg
cgctcgacgctggtcacgcgctggctcacgcgctgcattgtcgagactgcaaacctcaac
gagcgtgttgatttgatctccatgatcgtcgagatcttgaaggagctgcggtccctcaac
aacttcaacggcatgatggaagtggtatcggcgttgaacagcgcagcagtgcgccggctc
aaccacgcatgggccgaagtcaaccctcgtcgacgcgctcttttcgacgaatgcgtggag
cagctgatgggtggtaccaactacagtcgccttcggcaggccattgagcacgcgcccgcg
cccaagatcccattctttggcatgtacctcaccgacatgactttcatcgaggagggctcc
agcgataccatcccgtcaccgctgggcggcgtgcctctgatcaactttagcaagcggcgg
ctgctggcgcgaacgacgggtaccattcaacagtatcagaatcaacaatatgtattggct
gagtggcccttgctgcaggttggtgtcgtgtccccagccgtttgtttccttctttggctc
tcacccgggccttggcgcacgtgctttccctcacggcggctcccaccctaa

DBGET integrated database retrieval system