KEGG   Monosiga brevicollis: MONBRDRAFT_14402Help
Entry
MONBRDRAFT_14402  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K03099  son of sevenless
Organism
mbr  Monosiga brevicollis
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N HEAT_2 UCR_14kD
Motif
Other DBs
NCBI-GeneID: 5888793
NCBI-ProteinID: XP_001743231
JGI: 14402
UniProt: A9URL6
AA seq 436 aa AA seqDB search
MDRVEFSLFHPPSRREYRFATPDSEANILFDEKESEARGFRVVKAGTLEKLVELLTHPQH
TDTEYLRHFLTTYRSFCDSERLLELLLERYDVPDAEAVRHDAKQARFFHKQYRSPVRLRV
INVLKQWVEKHFYDFQAPQARPSDPVVVSRQEMRRRWYVSARTGHNRHGSAGTSPWHRAH
GRHSRSFRHLLNFHPQEVARQMTIIEFHLYKRIWPSELVGLMWTRRDKWQHAPNVLNMTV
RSTLVTRWLTRCIVETANLNERVDLISMIVEILKELRSLNNFNGMMEVVSALNSAAVRRL
NHAWAEVNPRRRALFDECVEQLMGGTNYSRLRQAIEHAPAPKIPFFGMYLTDMTFIEEGS
SDTIPSPLGGVPLINFSKRRLLARTTGTIQQYQNQQYVLAEWPLLQVGVVSPAVCFLLWL
SPGPWRTCFPSRRLPP
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggaccgagtagagttctcactcttccatccaccatcgcgcagagagtatcgattcgcc
actcccgatagcgaggccaacatattgtttgatgagaaggagtcggaagcgcgtggcttt
cgcgtcgtcaaggctggaacattggaaaagctggtcgagttgctgactcatcctcaacac
accgacaccgagtatctgcgccactttctgacgacctaccgttccttctgtgattccgag
cggctactggagctcctgttggagcgctacgatgtgccagatgctgaagcagtgcgccac
gatgccaagcaggctcgtttttttcacaaacagtaccgaagcccagtgcgtctgcgtgtg
atcaacgttctcaagcaatgggtcgagaagcatttttatgattttcaagcgcctcaggcc
cggcccagtgatccggtggttgtgtcgcgtcaggaaatgagaaggagatggtacgtcagc
gcgcgcacgggacacaaccggcatggatctgccggcacaagtccctggcatcgggcgcac
ggcaggcactctcgctcatttcgtcacttgctcaattttcatccgcaagaggtcgcgcgc
cagatgaccatcatcgagtttcacttgtacaagcgcatctggccatcggagctggtcggc
ctgatgtggacccggcgtgacaagtggcaacatgcaccaaatgtgctgaacatgaccgtg
cgctcgacgctggtcacgcgctggctcacgcgctgcattgtcgagactgcaaacctcaac
gagcgtgttgatttgatctccatgatcgtcgagatcttgaaggagctgcggtccctcaac
aacttcaacggcatgatggaagtggtatcggcgttgaacagcgcagcagtgcgccggctc
aaccacgcatgggccgaagtcaaccctcgtcgacgcgctcttttcgacgaatgcgtggag
cagctgatgggtggtaccaactacagtcgccttcggcaggccattgagcacgcgcccgcg
cccaagatcccattctttggcatgtacctcaccgacatgactttcatcgaggagggctcc
agcgataccatcccgtcaccgctgggcggcgtgcctctgatcaactttagcaagcggcgg
ctgctggcgcgaacgacgggtaccattcaacagtatcagaatcaacaatatgtattggct
gagtggcccttgctgcaggttggtgtcgtgtccccagccgtttgtttccttctttggctc
tcacccgggccttggcgcacgtgctttccctcacggcggctcccaccctaa

DBGET integrated database retrieval system