KEGG   Monosiga brevicollis: MONBRDRAFT_15226Help
Entry
MONBRDRAFT_15226  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     MONBRDRAFT_15226
Protein kinases [BR:mbr01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   MONBRDRAFT_15226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 341 aa AA seqDB search
SAQVLHRNLPIRLLFCIQQFLKLPFIVGCNPHFKHVHRTYLRAHENINSFGKIVNEQKEA
EYVELLNGFIDDHMNVVAQLAQGVRDCKLHKKAETDVLDSFMNNIINERIGLRLLIEHQV
SLHLNREHHAGVINKCMSPAKVVDKMVATASRVCLETYGSVPEVVVQGQTDITVPFVQAH
LEYILLELFKNAFRASMEFGDWLDPPEVVVTISESRNHFQIRVSDRGGGFSPEVGTNMWS
WSFTTVDEKEPLDYGLGATSVDASVKLAGAPSLGVGIPMSQAYANYFGGSLEIHSLENYG
ADAYLKLPSKAAHLVARTHDHAAQGTPFAHACFPSGLDAQS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
agcgcccaggtgctgcaccgcaatcttcccatccgtctactgttttgcatccagcaattc
ctcaagcttcctttcatcgtgggctgcaatccacactttaaacacgtgcaccgcacttac
ctgcgtgcccacgagaacatcaatagctttggcaagattgtgaatgagcagaaggaagcc
gagtatgtggagcttctcaacggtttcatcgacgatcacatgaacgtcgtggcccagttg
gcccaaggcgtgcgggactgcaagctgcataaaaaagccgaaaccgatgtgctcgactcg
ttcatgaacaacatcatcaacgagcgcatcgggctccgccttctcattgagcaccaagtc
tcgctccatctaaatcgagagcatcatgcaggtgtcatcaacaagtgcatgtcgccagcc
aaggtggtcgataagatggtggccacggcgtcacgcgtgtgcctcgagacctatggatcg
gtaccagaggtggttgtccagggtcaaacagacattactgttccctttgtccaagcccat
ctcgaatacattttgctggaactgtttaagaatgcctttcgcgcatccatggagtttgga
gattggttggacccaccggaggtggtcgtgactatttctgagagccgcaaccactttcag
attcgcgtgtcggaccgtgggggaggattttcacccgaggtggggaccaacatgtggagc
tggtccttcacgacagtggacgaaaaggagccactcgattatggtctgggcgccacatcg
gtagacgcctccgtcaaactcgccggtgcgcccagtctgggcgtgggtattcccatgagt
caagcctatgccaactactttggtggctccctcgagattcactcgttggagaattatggc
gcggacgcctatctcaaactgccaagtaaggcagcacacctcgtggcccgtacccatgat
cacgcagcccaaggcacaccttttgctcacgcatgttttccctctggcctggatgcgcag
agctga

  All links  
No link information was found.   
DBGET integrated database retrieval system