KEGG   Monosiga brevicollis: MONBRDRAFT_15842Help
Entry
MONBRDRAFT_15842  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
mbr  Monosiga brevicollis
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mbr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 136 aa AA seqDB search
MDAKGKGVLAGRAFRRGEYVCEYAGELIELEEAHRREERYRTEATAKGLDEMMCYMYFLR
HKSRTYCVDATQTGRVGRLINHSRAKPNLKTKLFVLDDRPHLGFIVKRDIEKGEELLYDY
GERDPATLRQMPWLKQ
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggatgccaagggcaaaggggtacttgcgggtagagccttccgtcgaggcgaatacgtg
tgtgagtatgccggtgagctgatcgaactggaggaggctcaccgacgcgaggagcgctac
cgaaccgaggccactgccaagggcctggatgaaatgatgtgctacatgtattttctgcgt
cacaagagtcgtacttactgcgttgacgccactcagacgggtcgagtcggccgcttgatc
aatcattcccgtgcaaaacccaacttgaagaccaagctctttgtacttgatgatcgccca
cacctgggttttattgtaaagcgggatatcgagaaaggagaggaattgctttacgactac
ggcgagcgcgaccccgccactttgcgccagatgccttggttgaaacagtaa

DBGET integrated database retrieval system