KEGG   Monosiga brevicollis: MONBRDRAFT_16143Help
Entry
MONBRDRAFT_16143  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 622 aa AA seqDB search
MTPREPGSSFFNSNDDDFVAKMKEAEAQIVIFYGSQTGTAEDFAMRLAGEAKRYGIKALV
IDPQDADMTQLSELSTIENAVALFCLATYGEGEPTDNAQAFHDLLEEKTEEENDWLENVN
YAVFGLGNKTYEHFNAMATFVDDKLKAGGGRRLIDVGMGDDDVNLEEDFLEWKDLLWSAV
CELMGKDANAISASFRTYQLVPVDERKKVFTGEPAIANSFKHQRPPYSQKNPFLAPIRVR
RELYKDEGRSCLHIELDISGSGIRYTAGDHAAVYPTNNASLVQAVAERLQVPLDDIFQLQ
AVDTFTRKSTPFPCPCTYRTALSHYVELTHTPSLNIIAEMVQYAKDEQQKERLAFLCSKQ
GRSEYNKHIHNRHLTILDVLAEFSSVEMPIDHLLELLPRMQPRYYSISSSSKTNPDRIHM
TVAIVTYKNGADTTVEGVATTWFCRLALDTDRVPMFVRRSTFRLPRKPKVPMIMIGPGTG
VAPFRGFIQERLFLMQDSEEQFGETHLFFGCQNESKHFMYRDEFEDAVMKKALSGLHTAF
SRDQATKVYVQHRLRERKEDVWRVLQAGGHLYICGDAKYMAQDVRKAIIEILVEMGDKTQ
QQALQFLKTMEEKHRFQQDVWS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcgcgaacctggcagcagcttcttcaacagcaatgatgacgactttgtcgcc
aagatgaaggaagccgaagctcaaatcgtcatcttctatggctcccagactggtaccgca
gaagactttgccatgcgtcttgctggcgaagcgaagcgctatggtatcaaggctctagtc
attgacccccaggatgcggacatgacgcagctctccgagctcagtaccatcgaaaacgct
gttgccctcttctgcctggccacgtacggtgaaggcgagcccaccgacaacgcccaagcc
ttccacgacctcctggaagagaagacggaggaggagaacgactggctcgagaatgtcaac
tacgccgtctttggccttggcaacaagacctacgagcacttcaacgccatggccaccttt
gtggacgacaagctcaaggccggtggtggccgccgtctcattgatgtgggcatgggtgat
gacgacgtgaacctggaagaggattttctggaatggaaggacttgctctggtccgccgtc
tgcgagctcatgggcaaggatgccaacgccatcagcgcctccttccgcacgtatcagctg
gtgcccgtggacgagcgcaagaaggtgttcaccggtgaacctgccattgccaactcgttc
aaacatcagcgcccgccatacagccagaagaacccctttctggccccaatccgtgtgcgc
cgcgagctgtacaaggatgaagggcgcagctgcttgcacattgagctcgacatctctggc
tcgggcattcgctacactgccggtgaccacgcagccgtctaccccaccaacaacgcttcc
ctggtccaggctgtcgccgagcgcttgcaagttccccttgatgacattttccagctgcaa
gccgtcgataccttcacccgcaagagcacccccttcccctgcccgtgcacgtatcgcaca
gccctgagccactacgtcgagctgacacacaccccctctctcaatatcattgctgagatg
gtgcagtacgccaaggatgaacagcagaaggagcgcctcgcctttctttgcagcaagcaa
ggccgcagcgaatacaacaagcacattcataaccgtcacctcaccatcctcgacgtcctg
gccgagttctcgtccgtggagatgcccatcgaccatctgctggagttgttgccgcgcatg
cagccccgctactactcgatcagcagcagcagcaaaaccaaccccgaccggatacacatg
acggtggccatcgtcacctacaagaacggtgcggatacgacggttgagggtgtggccacc
acctggttctgtcgcttggcgctggacaccgatcgtgtccccatgtttgttcgccgctcc
actttccgcctgccacgcaagcccaaggtacccatgatcatgatcggcccgggcaccggc
gttgccccctttcgtggctttatccaggaacgtttgttcctcatgcaagattcagaagag
cagtttggcgaaacacacctcttctttggttgtcaaaacgagagcaagcatttcatgtac
cgcgacgagtttgaggatgccgtgatgaaaaaggcgctgagcggcttgcatacggctttc
tcccgcgatcaggccaccaaggtgtatgtgcagcaccgcctgcgtgagcgcaaggaagat
gtatggcgtgttcttcaagcaggaggccacctgtacatttgcggtgatgccaaatacatg
gcgcaagatgtccgcaaggccattattgagattctggtcgagatgggcgacaagacacag
caacaagccttgcagtttctcaagaccatggaagagaagcatcgctttcagcaagacgtt
tggtcataa

DBGET integrated database retrieval system