KEGG   Monosiga brevicollis: MONBRDRAFT_16342Help
Entry
MONBRDRAFT_16342  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
mbr  Monosiga brevicollis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MONBRDRAFT_16342
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     MONBRDRAFT_16342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 827 aa AA seqDB search
MVRPAHPSSNVATGTPAKAAATSTNGAADADAPTWRHFSCVWCKYSRKKHKSWQGDAVLS
VKGSTVILQDLEAKEIGKSSTLRPADLVSLQDGETLNFSGKIIEIMGTIERKRYESGACF
RTASVSSATLTARTASAKLLFAVSPILCHARGLRHSLQSVKQLKPRYDPNQPGALVLKPP
PVRVHSHLHMAAPSCVPLVVDPHLSTILRPHQREGVRFVIECVAGCKSDLEGTGCILADD
MGLGKTLQCISVVWTLLKQGFDGKPLCQRALIICPGSLVKNWEAEFRKWLGVERIKTFAI
SSANKLEHVQQAKAFPVVIVSYEMYLRCMDLLKQVRFDVVICDEAHRLKNANAKTTRILS
GLATRRRIALTGTPVQNDLQEFFTLVDFVNPGLFGSSAKFKRLYETPIVRARQHDATPAE
KDLGEARAEELNRTIHEFVLRRTKEVNAAYLPPKTDYVVFCQPTPLQLQLYQRLIATQFV
RSCMNAVRGGTRHLLVIAALRMLCNAPSLLAGRQSANVADSDFDRVLKDVRRLLPGSDDN
DVAARTTLLEGSGKVALVRHMLRQWREKTDERALLVSNSTRCLDILQLLCEAEGWPFLRL
QGSTPTHQRLEMVNRFNARHHDDFVFLMSSKAGGVGLNIVGASRLVLFDTDWNPSHDLQA
MARIWREGQTRPVFIYRLVATGTIEEKIYQRQIVKSALGTTVMEDKETEQAFSTKDLKEL
FQLHLDVASETVQLMRKKKDKISSSLVNWGVYQPPFPLDDLRDSLTFEGVPENLATCLLE
HLNDDNTPPAEPAIDDNADAGCEIDALLAPTSDETEDEMLERALTDM
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggtccggccagcccacccgagctcaaatgttgccacgggtactccggccaaggcagca
gccaccagcacaaacggtgccgctgacgcggatgcgccgacctggcggcacttttcctgc
gtttggtgcaagtattcccgaaagaagcacaaaagctggcaaggtgatgccgtcctctcc
gttaaaggctccacagtcatccttcaggatcttgaagcaaaggaaatcggcaagagctca
accttgcggccggccgacctcgtgtccctccaagatggcgagactctcaacttttccggc
aagattatcgagatcatgggcaccattgaacgcaaacgctacgagagcggtgcctgcttc
cgcaccgcctccgtgtcttcggcaaccctgaccgcacgcactgcttctgctaaattgctt
ttcgccgtctcacctatcctgtgccatgctcggggcttgcggcactccctgcagagtgtg
aagcagctcaagccccgttatgatcccaatcagcccggtgccctcgtcctcaagcctcca
ccggtgcgagtgcattcccatctacacatggcggccccatcatgcgtccctttggtggta
gacccccacctgtccacgatcctgcgtccccatcagcgcgaaggcgtgcgattcgttatt
gaatgcgtagccggctgcaagagcgatttggagggcaccggctgtattttggctgatgac
atgggtctcggcaagacgctgcagtgtatctcggtagtgtggaccctgctcaagcagggc
tttgacggcaagcccctttgccagcgtgcgctgatcatttgccccggcagcttggtcaag
aactgggaagcggaatttcgcaagtggctcggagtcgagcgcatcaagacttttgccatc
tcctctgccaataagctcgagcacgtccaacaggcaaaggcttttccggtcgttattgtg
tcctacgaaatgtatttgcgctgcatggacctgctcaagcaagtgcgattcgacgttgtc
atttgcgatgaagcgcatcgtctcaaaaatgccaatgccaagaccacccgcattctctct
ggcctcgcgactcggcgacggattgccttgaccggcacgcccgtgcaaaacgacctgcaa
gagttttttaccctggtcgattttgtcaacccaggcctctttggctccagcgcaaaattt
aagcgtctatacgaaacacccattgtgcgagcgcggcagcacgatgcgacaccggctgaa
aaggatctgggtgaagctcgagcggaagagctgaatcgcacgatccatgagtttgtgtta
cgccgaacaaaggaagtgaatgcggcctacctcccccccaagaccgattacgttgtattt
tgccaacccacgcctcttcagctacagctataccagcgtcttatcgccacccagtttgtg
cgctcatgcatgaacgccgtgcgtggtggcacacgacacttgctcgtcattgcagcactg
cgcatgttatgcaatgcccctagcctccttgcggggcgccagtctgccaatgtggccgac
tcggactttgatcgcgttctcaaggacgtgcgccgattgctgcccggttcagatgacaat
gacgtggcggcacgaacgaccttgctagagggcagtggcaaggtggctttagtgcgacac
atgctgcgtcagtggcgtgagaaaacggacgagcgagcgctgctggtatccaactcaaca
cgctgtctagacatcctgcaattgctctgtgaggcagaaggctggccttttctgcgcctg
caaggctcgacgcccacgcaccagcgacttgagatggtcaaccgtttcaatgcgcgtcac
cacgacgactttgtctttctgatgagctccaaggccggtggtgtgggcctcaacattgtg
ggcgcctcccgcctcgttctgtttgacaccgattggaacccgagccacgacctgcaggcc
atggcacgaatttggcgagagggtcagacccggcccgtgttcatttaccggctggtcgcc
accggcaccattgaggaaaagatttaccaacgacagattgtcaaatcggccctcgggacg
actgtcatggaggacaaggagacggagcaggccttctccaccaaagatctgaaagaactg
tttcaacttcatttggacgtggcttcggagacggtacagctgatgagaaagaagaaggac
aaaatatcctctagcctggtcaactggggcgtgtatcagccgccctttcctctcgatgac
ctgcgagactcgctcacctttgaaggcgtgcccgagaacctggccacctgcttgctcgag
cacctcaacgacgacaacactccgccggccgagccggccatcgatgacaatgccgatgct
ggttgtgaaatcgacgccctccttgccccaacgagcgatgagactgaagatgaaatgctg
gagcgtgcgctcactgacatgtag

DBGET integrated database retrieval system