KEGG   Monosiga brevicollis: MONBRDRAFT_16468Help
Entry
MONBRDRAFT_16468  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mbr  Monosiga brevicollis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbr00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 263 aa AA seqDB search
MEAIRVSGLDGSAIAVHLNGATVTEWKNQRSDNAFFVSERSEWQEGRPIRGGIPLAFPQF
AGDGPLPNHGLARTLPWTVAEQATGYIQLCLQESAASRELWPYAFDATYSVTFNASSFSS
VLEITNPHARAAGSAMQFQALQHTYYQLDAVTTLQLSGLEGRTFLDKLTGKSPKQAPMTP
LTIQAETDAIFVPSQNPRPVLLQLEGAPVIWNPWIAKSAAMADFGDEEYQHMVCIEPGCV
SQPVTLEPGATFRLEQHITLLVC
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgatcagggtcagtgggctggatggatcggccattgctgttcatctcaatggt
gccacggtgacagagtggaagaatcagcgcagtgataatgccttcttcgtgtcggagcgt
tcagagtggcaagagggtcgcccaattcgaggtgggatccctctggcctttccccagttc
gccggtgatgggcctctgcccaatcatgggttggctcgcacgctgccctggactgtcgcc
gagcaggccaccggctacattcagctctgcctacaagaatcggccgcgtcccgggaactg
tggccgtatgcctttgacgcaacttattccgtgacctttaatgcgtccagcttcagctcg
gtgttagaaattaccaaccctcatgcacgcgcggcaggcagcgccatgcagttccaggct
ctgcaacacacctactatcagcttgatgcagtgacaaccctgcagctttcaggactggag
ggtcgcacctttctcgacaagttgacagggaagagccccaaacaagccccaatgacgccc
ctgacaatccaagcagagaccgatgccatcttcgttccttcacaaaatcctcgccccgtg
ctgctccaactcgaaggagcacccgtgatttggaatccttggatcgccaagagcgccgcc
atggctgattttggggacgaggagtaccagcacatggtttgcatcgagccagggtgcgtc
tctcagcccgtgacgctcgagcccggtgccacctttcgcttggaacaacacattacccta
ctggtatgttag

DBGET integrated database retrieval system