KEGG   Monosiga brevicollis: MONBRDRAFT_16837Help
Entry
MONBRDRAFT_16837  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mbr  Monosiga brevicollis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MONBRDRAFT_16837
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MONBRDRAFT_16837
Enzymes [BR:mbr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MONBRDRAFT_16837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 145 aa AA seqDB search
DLLITHWQVLLVVNVASECGYTDPRYEELSHLIRILGKRGIEVLAFPCNQFGGQEPGTAE
EVRDFGLTNYEADFVYFDKVDVQGVRQAPIYKWLLDQTGATIDWNFGMRVTLSPARLSRL
YACNTVRFTIQCSTSGTCPATPDTA
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gacctgctgatcacacactggcaggtgcttctcgtggtcaacgtggctagcgagtgtggc
tacacagacccccgttacgaggagttgtcacaccttatccgcatccttggcaagcgcggc
atcgaggtcctagccttcccgtgcaaccagtttggtgggcaagagcccggtaccgcggag
gaggttcgtgactttgggctcacaaattacgaggcagactttgtctactttgacaaagtc
gacgtgcaaggcgttcgacaagcccctatctacaaatggctgctggaccagactggcgca
accatcgactggaattttggtatgcgtgttaccctttcacctgcacgcctgtcccgactc
tatgcatgcaacactgtccgtttcaccatccaatgctcaacatctggaacctgccctgcg
acgcccgacacggcttag

DBGET integrated database retrieval system