KEGG   Monosiga brevicollis: MONBRDRAFT_1850Help
Entry
MONBRDRAFT_1850   CDS       T01042                                 

Definition
hypothetical protein
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 246 aa AA seqDB search
PGTSNLNRYNNILPNPRTRVRLSKLNDDDITTYINANYVHGYDGAHGTYIATQGPTPTTT
PDFWRMVWETNANSIVMVTGLQEKGREKCARYWPTVLFNEREGLGDMQAGFVNVAVLAGV
RSNGYIATKLRIKHDKSDTERIVMHYWFNSWPDHGVPSETGNVVKMLQAVREWSDDPERP
WIVHCSAGVGRTGTFITIDIGMRLLQERGRCNVNEIIRRLRKDRCAMVQHPEQAEFAYKV
LSEYAA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
cccggcacctccaatctgaatcgttacaacaacatcttgcccaatcctcgtacgcgcgtg
cgcctgagcaagctcaacgacgatgacattaccacctacatcaatgccaactatgtgcac
ggctacgacggtgcccatggcacgtacattgcaacccagggacccacgcccaccacgacg
cccgacttttggcgcatggtctgggaaacaaacgccaactccattgtgatggtgactggt
ctgcaagaaaagggacgtgaaaagtgtgcccgctattggcccacggtcctctttaacgaa
cgcgagggccttggggatatgcaagccggctttgtcaacgtagccgtcttggcaggcgtt
cgttcaaacggttacatcgcaaccaagctgcgcatcaagcacgacaagagcgacacggag
cgaattgtcatgcactactggttcaactcctggcccgaccacggcgtgccctcggaaact
ggcaatgtcgtcaaaatgctgcaggccgtgcgcgagtggagcgatgatccagagcggcca
tggatcgttcattgctctgcgggtgtcggtcgaactggtaccttcatcacgatcgatatt
ggcatgcgcttgctgcaggagcgcggccgctgcaacgtcaacgagattattcgtcgcctt
cgcaaggaccgttgtgctatggtgcaacatccagagcaggcagaattcgcctacaaggtt
ttgagcgagtatgccgcg

DBGET integrated database retrieval system