KEGG   Monosiga brevicollis: MONBRDRAFT_18656Help
Entry
MONBRDRAFT_18656  CDS       T01042                                 

Gene name
PI3K-CA_alpha
Definition
PI3K-CA alpha
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
mbr  Monosiga brevicollis
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MONBRDRAFT_18656 (PI3K-CA_alpha)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    MONBRDRAFT_18656 (PI3K-CA_alpha)
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     MONBRDRAFT_18656 (PI3K-CA_alpha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1016 aa AA seqDB search
MESVICLLPTGMIVKLDVAIGGSQTYNDIKNNVWQAASGLPFFHELKQPQSYGFSAVGTD
GEMLELHDDDLFDRTRLYTPWLKVCSRGSKEEQRFNLDISRLIGKQLSEFDFIRDPEVVA
FRQSILSICQNAQKLRQSEGIEGAALHRFPPNTISSPFPQHLKAKLNKKEQFILMVYFSS
DQASKTVCDINQTPDELIKVIVRKGRVGQKLGSDNPTEYVLKVHGRDEYLLGKFRMGDYK
YVRHCLAHGYTKTDLSDHNCRLVLERRDDMYKKIPQANTDKMLMSKSALRLEEPTPANPA
QAMTWFGAEADSKFSVLIRSAHNVITGKLFSIGIKACVFLGDKPISDEEATRFVPPEENM
SWAQPIEFDLAIKDLPRDARLCIALFGVWANPLKVKKRKNFRNEYVLAWTNISIMDFRGF
LRQGEYTLATWTVEDGENAALFNPLGTTTTNPTQGSSPTLTIEFTKFQRELCYPTSDYTQ
QQRIYEGTTHPLEPNARERLERLILADPLYAFTPDDFDLLRRYRDNFKENPAALSKCLRA
VEWSNHEYVWDVEEMLSTWAAVRPEEALELLDSGFSDRAIRSHAVQRLEPMEDDQLLEYL
LQLVQVLKYETYLDNDLSRFLLKRALQSQRVGHFFFWFLRSEIHNPECGVRFGLLLEAYC
RGCGSHFPDLHAQVQVLNQMEDIADTLKDKNIKDKDKKQCAIELVEKSTFPAFQLPLEPS
LRLEGVKVRKVFDSAQRPLWIEFDNADKMGNSFNVMFKNGDDLRQDMLTLQLIAIMDRLW
QEQGLDLQMTPYACLSTGDMVGLLEMVMGAKTLWQIQGKIKNVMLNDDTLNNFLKASNAE
TPAYDEACNNFMLSCAGYSVATYVLGVADRHNDNIMLKETGQFFHIDFGHFLGNWKYKFG
IQRERVKFILVPEFIHIITRGEGQRSKKWVEFKDTCKQAFRIVRQNASLFINLLNMMLST
GIPELTTHKDVSYLRETLFLDDTEEQAVAKFEDEIAIAIRDSNTVKINWAFHGYKH
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggtcatctgcctattgcccacgggcatgatcgtgaagctggatgtggccatt
ggtgggagtcagacatacaacgacatcaaaaacaacgtttggcaggcagccagtggcttg
cctttcttccatgagctcaagcaaccccaaagctatggcttctcagccgtgggcacagat
ggcgagatgctcgagctgcacgacgatgacctctttgatcgcacccgcctctacacgccc
tggctcaaggtttgctcgcgcggtagcaaggaggagcagcggttcaacttggatatttcc
cggctcattggcaaacagctgagcgaatttgattttatccgggatccagaggttgtggcc
tttcgccagagcatcctcagcatttgccagaatgcgcaaaaattgcgccaaagtgaaggc
atcgagggtgctgccctgcaccgcttccctcccaacacaatctcatctcccttcccacag
catttgaaggccaagctcaacaagaaggagcaattcattctcatggtctatttcagcagt
gatcaagcctcaaagacggtgtgtgatatcaatcagacgccggatgaactgatcaaggtg
attgtgcgcaagggacgcgtgggtcagaaacttggctcggacaacccgacggagtacgtc
ctcaaggtgcacggccgcgatgagtacttgttgggcaagtttcgcatgggcgactacaaa
tatgtgcgccactgtctggcacatggctacaccaaaaccgacctctccgaccacaactgc
cgtctggttttggagcgccgtgacgacatgtacaagaagatacctcaggccaatacagac
aagatgctcatgagcaagtccgcccttcgtctagaagagcccaccccggccaacccagcg
caggccatgacttggttcggtgccgaagccgacagcaagttttctgttctgattcgcagt
gcgcacaacgtcatcactggcaaacttttttccatcggcatcaaggcttgcgtctttttg
ggcgacaagcccatttccgatgaggaagccactcgtttcgtgcctcccgaggagaacatg
agctgggcccagcccatcgagtttgatttggcgatcaaggacctcccccgtgatgcccgc
ctttgcatcgctctctttggcgtgtgggccaacccgcttaaggtcaaaaagcgcaaaaat
ttccgcaacgaatacgtgttggcctggaccaacatctccatcatggactttcgcggtttt
ttgcgccaaggcgagtacaccctggctacatggaccgtcgaggatggtgaaaatgctgcc
ttgttcaaccccctcggcacaaccaccaccaacccgactcagggctcctcgcccaccctg
accatcgaatttaccaagttccaacgtgagctttgctaccccacgtcagactatacgcaa
caacaacgcatttacgagggcaccacacatcccttggagcccaatgctcgcgaacgtttg
gaacgcctgatccttgctgatcccctctatgcattcactccagacgactttgacctgctt
cgccgctaccgggacaacttcaaagaaaaccctgctgctctctccaagtgcttgcgtgca
gtggaatggtccaaccacgaatatgtttgggatgtcgaagagatgctcagcacatgggcg
gctgtgcggcctgaggaggcgctggagcttcttgactcgggtttcagcgatcgtgctatc
cgctcccatgctgtgcagcgcctcgaacccatggaggatgatcagctcctggaatacctt
ttgcagctcgtgcaggtattaaagtatgaaacgtatctggacaacgacttgagtcgattc
ctgctgaagcgtgccctgcagtctcagcgcgttggccacttcttcttctggtttctgcgc
tcggaaattcacaaccccgagtgcggcgtccgctttggccttctcctcgaggcgtactgc
cgaggttgcggatcccactttccagacctacacgcgcaggtgcaagtgctgaaccaaatg
gaagatattgctgacaccctcaaggacaaaaacatcaaggacaaggataagaagcagtgt
gccattgagctcgtggagaagagcacctttcccgccttccagctgccgctggagccctct
ttgcgcttggagggcgtcaaggtccgcaaggtctttgattcggcgcaacggcctctctgg
atcgagtttgacaacgcagataagatgggcaactccttcaacgtgatgttcaagaatggc
gacgacttgcgccaggacatgttgactctgcagctgattgccatcatggaccgcctgtgg
caagaacaaggtctcgacctgcaaatgaccccttatgcctgcctttccacgggtgacatg
gtggggctccttgagatggtcatgggtgccaaaactctttggcaaatccaaggcaagatc
aagaatgtcatgttgaacgatgacaccctgaacaactttttaaaggccagcaatgctgag
acgccggcctatgacgaggcgtgcaacaactttatgctctcttgcgctggctactcagtg
gccacctacgtgcttggtgtggctgatcgccacaatgataacattatgctcaaggagacg
ggccagttcttccatattgattttggtcactttttgggcaactggaagtacaagtttggc
attcagcgtgagcgtgtcaagtttatccttgttccagagttcatccacatcatcacccgc
ggcgagggccaacgctccaagaagtgggtggagttcaaggacacatgcaagcaagccttc
cgcatcgtgcgccaaaatgccagtctgttcatcaatctgcttaacatgatgttatcaacg
ggcattcctgagctcaccacgcacaaggatgtttcgtacttgcgcgagactctgttcttg
gatgataccgaggaacaggccgttgccaagtttgaggatgagattgcgattgccattcgc
gattcaaacactgtcaaaatcaactgggctttccatggctacaagcactga

DBGET integrated database retrieval system