KEGG   Monosiga brevicollis: MONBRDRAFT_18821Help
Entry
MONBRDRAFT_18821  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     MONBRDRAFT_18821
Protein kinases [BR:mbr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   MONBRDRAFT_18821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 400 aa AA seqDB search
MSTGRRRKPRPTLSIDLIPQTPTSPDSGRSISPSPLTVVSKQQEELTQRPLDAKQLQRVE
DFLFRKAAFLSTEDVQPTDLRELVVLGRGNGGSVCKVLHVKSNIIMARKSIHLEIRPEVR
NQILRELRILHKCSSPHIIGFYGSFWHDGEINILMEYMDGGSLDAVVRRIGRIPENVLAE
ITYCILDGLVYLRDKLSIMHRDIKPSNVLVSSDGDCKLCDFGVSGELHNSLANTFVGTRS
YMSPERLQGQRYAVESDLWSLGLSLLEMATGVFPIPAENLKKGLAPMHPPPDKPLEAHAP
DATQSMAIFELLANIVESEPPRLPDDAGFSDSFINFIDACLKREPSERMPLAELIQHPWL
EDMRASQPVNMAEWVRSTMVPCELAARDQEKAAHAVVPSE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgggtcggcggcgcaagccgcgtcccacgctttccattgaccttatcccacag
acgcccacttcccccgattctggccgaagcattagtccatcaccattgacggttgtctcc
aagcaacaagaggagctgactcagcgacctctcgacgccaaacagctccaacgcgtcgaa
gactttctgttccgaaaggcggcctttctctcaactgaggatgtccaacccacggacctt
cgcgagcttgtcgttctcggtcgaggcaacggcggcagcgtctgcaaagttttacatgtc
aagtccaatatcatcatggcgcgcaaaagcattcatcttgagattaggcctgaagtgcgc
aaccaaattttgcgcgagctgcgcattcttcacaaatgttcttcaccgcacatcatcggc
ttttacggctccttttggcacgatggtgaaatcaacatcctgatggaatacatggacggc
ggttccctcgatgcagtcgtgcggcggataggccgcattcccgagaacgtattggcagag
attacctattgcatcctggatggtcttgtttatttgcgagacaagctctctatcatgcat
cgcgacatcaaaccatcaaacgttttggtcagctccgacggtgactgcaagctttgtgac
tttggcgtgagcggtgaacttcataattcgctcgccaacacctttgtgggcacacgctcc
tacatgtccccggaacggctgcaaggccagcgctatgccgtcgagagcgacctctggtcg
cttggcctctcgctccttgaaatggcaactggcgtgtttccaatccctgccgagaatttg
aagaagggtcttgccccgatgcaccctccgccagataaacccctggaagcccatgctccg
gacgcaacacaatccatggccatctttgagctgctcgctaacattgtcgagagcgagcca
cctcgcctccctgatgatgccggcttttccgactcgtttatcaatttcatcgatgcctgc
ttgaaacgggagccttcggagcgcatgcctctggccgagctcattcagcacccatggctc
gaagacatgcgtgcctcccaacccgtcaatatggccgagtgggtccgttctaccatggtg
ccctgtgaactcgcggctcgcgatcaggagaaagctgcccatgcagttgtgccaagcgag
tag

DBGET integrated database retrieval system