KEGG   Monosiga brevicollis: MONBRDRAFT_18821Help
Entry
MONBRDRAFT_18821  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     MONBRDRAFT_18821
Protein kinases [BR:mbr01001]
 Serine/threonine kinases: STE group
  STE7 family
   MONBRDRAFT_18821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5890624
NCBI-ProteinID: XP_001745338
JGI: 18821
UniProt: A9UXW3
AA seq 400 aa AA seqDB search
MSTGRRRKPRPTLSIDLIPQTPTSPDSGRSISPSPLTVVSKQQEELTQRPLDAKQLQRVE
DFLFRKAAFLSTEDVQPTDLRELVVLGRGNGGSVCKVLHVKSNIIMARKSIHLEIRPEVR
NQILRELRILHKCSSPHIIGFYGSFWHDGEINILMEYMDGGSLDAVVRRIGRIPENVLAE
ITYCILDGLVYLRDKLSIMHRDIKPSNVLVSSDGDCKLCDFGVSGELHNSLANTFVGTRS
YMSPERLQGQRYAVESDLWSLGLSLLEMATGVFPIPAENLKKGLAPMHPPPDKPLEAHAP
DATQSMAIFELLANIVESEPPRLPDDAGFSDSFINFIDACLKREPSERMPLAELIQHPWL
EDMRASQPVNMAEWVRSTMVPCELAARDQEKAAHAVVPSE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgggtcggcggcgcaagccgcgtcccacgctttccattgaccttatcccacag
acgcccacttcccccgattctggccgaagcattagtccatcaccattgacggttgtctcc
aagcaacaagaggagctgactcagcgacctctcgacgccaaacagctccaacgcgtcgaa
gactttctgttccgaaaggcggcctttctctcaactgaggatgtccaacccacggacctt
cgcgagcttgtcgttctcggtcgaggcaacggcggcagcgtctgcaaagttttacatgtc
aagtccaatatcatcatggcgcgcaaaagcattcatcttgagattaggcctgaagtgcgc
aaccaaattttgcgcgagctgcgcattcttcacaaatgttcttcaccgcacatcatcggc
ttttacggctccttttggcacgatggtgaaatcaacatcctgatggaatacatggacggc
ggttccctcgatgcagtcgtgcggcggataggccgcattcccgagaacgtattggcagag
attacctattgcatcctggatggtcttgtttatttgcgagacaagctctctatcatgcat
cgcgacatcaaaccatcaaacgttttggtcagctccgacggtgactgcaagctttgtgac
tttggcgtgagcggtgaacttcataattcgctcgccaacacctttgtgggcacacgctcc
tacatgtccccggaacggctgcaaggccagcgctatgccgtcgagagcgacctctggtcg
cttggcctctcgctccttgaaatggcaactggcgtgtttccaatccctgccgagaatttg
aagaagggtcttgccccgatgcaccctccgccagataaacccctggaagcccatgctccg
gacgcaacacaatccatggccatctttgagctgctcgctaacattgtcgagagcgagcca
cctcgcctccctgatgatgccggcttttccgactcgtttatcaatttcatcgatgcctgc
ttgaaacgggagccttcggagcgcatgcctctggccgagctcattcagcacccatggctc
gaagacatgcgtgcctcccaacccgtcaatatggccgagtgggtccgttctaccatggtg
ccctgtgaactcgcggctcgcgatcaggagaaagctgcccatgcagttgtgccaagcgag
tag

DBGET integrated database retrieval system