KEGG   Monosiga brevicollis: MONBRDRAFT_19294Help
Entry
MONBRDRAFT_19294  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
mbr  Monosiga brevicollis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MONBRDRAFT_19294
Exosome [BR:mbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MONBRDRAFT_19294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1666 aa AA seqDB search
MAGLPIKFQEMLQLTSMGIDAASISFNTLTMESEKYICVREAKAGKTELVIVDVANKSVE
RKPGGADNAIMNPAANIIALKAAKVLQIFNLETKQKLKAHTMVDDVQFWRWVDDNTLGIV
TAQSVYHWALEGDSAPVKMFDRHESLNGTQIINYRTDAAKQWLILIGISARDNRVVGSMQ
LYSVERKVSQPIEAHAACFTQFKMPGNPHPSNVLCMANRGAAGAKIHVIEVGAPAAGNRP
FTKCNADIFFPQDAAGDFPVAMQIGPKYQMAYVITKLGYLHLFDVETASCIFMKRISAET
IFITAPQDSVSGLIGVNRQGQVLSVTVDEANLVSHVTSQLKNPQLALKLAVRADLPGAED
TFVQQFNHLYGQGQFAAAAKVAAEAPRGILRNQDTIQKLQQAPQQPGQQPPILQYFSTLL
ETSRLNAHESVELCRPVVQQNRTELLEKWLKEDKLECSEQLGDMIKPISPKFALSVYLRA
EASAKVIQCFAETGEFDKLVLYAKKVNYQADYAYILRMILRSSPDKAVPFATSLVKEDPP
LANINSIVDAFDEMKLVQPCTAFLLEVLKPNLPEQGDLQTRLLEMNLMQAPQVADAILGQ
GMLTHFDKQRVAQLCEQCGLTQRALENYTDLYDIKRAIIHTQMLDRNWLVQYFSTLSVDD
SIECLREMLSKNIRQNLQVCVQIASKYHEQIGAAALIDLFESFKSAEGLFYFLGAVVNSS
EDPEVHFKYIEAACKTGQTKEVERICRTSNHYDPERVKNYLKEAKLSDQLPLIIVCDRFD
FVQDLVMYLYKNDQRKFIEVYVTKVNPKRLPAVVGGLMDVDCSEDTIKNLIMVVRGEFST
DDLVAEVEKRNRLKMLLPWLEGRVQEGVTEPATHNALAKIYIDSNTNAERFLKENQYYDS
AVVGKYCEKRDPQMAFVVYERGNCDDQLIEICNANALHKNLARYLVRRKDSDLWARVLDE
SNDQRRSVIDQVVQTALLEAQDPDEISVAVKAFIAADIPSELIELLEKLVMGESMFSKNS
NLQNLLIVTAIKADGARVSEYINRLDDYDASTIAQVAIEHSQFEDAFAVFKKFEVHTEAV
KVLINDIKNLDRAYEYAERVNNADVWSLLAGAQLRDGMIKEAIDSYIKANDPSAVQGVVM
AAKTHDKFEDLIRYLQMARKKSRDAAIETELVFAYAKTNRLADMEEFITSQHIANVQEVG
DRCYDEQLWEAAKILYSNASNFARLSSTLVHLKEYQAAVDAARKANSTRSWKEVCFACVD
HQEFKMAQICGLNIIVHADELGELISYYLVRGHFEPLIALLEAGLGLERAHMGLFTELAI
LYGRYQPEKMKEYLEMYWSRVNIPKVLRAAEEAHLWPELVFLYDKYDEYDNAVITMMEHP
SEAWHDKRFLEMIVKVANTELFYKAVDFYLSHKPLLLNDLLTAVVGRIDHTRAVKLLKDR
DVVAMAKPYLKTVQQNDNVVVNEALNDVLIHEGDYEGLRTSIDGYKNFDNIALAQRLEKH
ELLEFRRISAYLYKGNNRWKQSVDICKKDRLYKDAMQYAAESRDPEAAKALLDYFVEIDD
KECFAACCFACYDLLRPDVVTELAWRNGMMDFAMPYLIQVMREYMDKVDKLDTHHIEKKA
EEESQPPAPALGMPQLMLTGPGMMGGMMGGMQGGMPQGGMPQGGMY
NT seq 5001 nt NT seq  +upstreamnt  +downstreamnt
atggcgggccttcccatcaagtttcaggagatgcttcagctcacaagcatgggcattgat
gcggcctccatctccttcaacacactgaccatggagtcggaaaagtacatttgcgtccgt
gaagccaaggccggtaaaaccgagcttgtgattgttgatgtcgccaacaagtcggtggaa
cgtaagcctggaggcgcagataatgccattatgaaccctgcagccaacatcattgcgctc
aaggcagccaaggtcctgcagatcttcaaccttgagacgaagcaaaaactcaaggcgcac
acgatggtggacgacgtccagttttggcgctgggtggatgacaatacactgggtatcgtc
accgcacagtccgtctaccactgggctcttgagggtgattctgctcccgtcaagatgttc
gatcgccatgagagcctcaacggcacccagatcatcaactaccgcactgatgctgccaag
caatggctcatcctgattggcattagcgcgcgcgacaaccgcgtggttggttcgatgcag
ctctattcggttgagcgcaaggtgtctcagcccatcgaggcccatgccgcctgcttcacg
cagttcaaaatgccgggaaatcctcacccctccaacgtcctctgcatggccaaccgtgga
gctgcgggcgccaagattcatgtcattgaggtcggcgcgccggccgctggcaaccgcccc
ttcaccaagtgcaacgccgacatcttcttcccccaggacgctgctggtgatttccccgtc
gccatgcaaattggccccaagtatcagatggcctacgtcatcaccaagctgggctacttg
catctgtttgacgtcgagacggcctcgtgcatcttcatgaagcgcatttccgccgagacc
attttcatcacggccccccaggacagcgtcagcggcctcatcggcgtcaaccgccagggt
caggtgctctccgtcaccgtggacgaggccaatctggtcagccatgttacttcacagctc
aagaacccgcaacttgccctcaagctggccgtgcgagctgatctgcctggtgcggaggat
acctttgtccagcagtttaaccacctctacggccaaggccagtttgctgctgccgccaag
gtggccgctgaagctcctcgcggtatcctgcgcaaccaggacactattcaaaagctgcag
caggctccacaacagccgggacaacagccccccatcctgcagtactttagcactttgctt
gaaacttcccgcctcaacgcccacgagtctgttgagctctgccgccccgttgtgcagcag
aaccgcaccgagctcctcgaaaagtggctcaaggaggacaagctcgagtgcagcgagcaa
ctgggcgacatgatcaagcccatcagccccaagtttgccctctccgtgtatttgcgtgcc
gaagcctcggccaaggtgattcagtgcttcgctgagactggcgagtttgataagctggtc
ctctatgccaagaaggtcaattaccaagccgactacgcctacattctgcgcatgattctg
cgctccagcccggataaggccgtgccctttgccaccagtctggttaaggaggatcctcct
ctcgctaacatcaactctattgtggacgcgtttgacgagatgaagcttgtccagccttgc
accgcgttccttctggaggttctgaagcccaatcttccggagcagggcgacctgcaaact
cgccttttggagatgaacctcatgcaagcccctcaagtcgccgacgctattttgggtcag
ggcatgctcacgcactttgacaagcagcgtgtggctcagctctgtgaacagtgtggcctc
acccagcgcgctctggagaactacactgacctgtatgacatcaagcgtgccatcattcac
actcagatgctggaccgcaactggcttgtgcagtacttctccacgctctcagtggatgat
tctatcgagtgtctgcgggagatgttgagcaagaacatccgccagaacctgcaggtgtgc
gttcagattgccagcaagtaccatgagcagattggcgccgccgctcttatcgaccttttc
gagtcattcaagtcggccgagggcctcttctactttttgggtgctgttgtcaacagctcg
gaggaccccgaagtgcacttcaagtacattgaggcagcatgcaagacgggtcagacgaag
gaggtggagcgcatttgccgcaccagcaaccactacgaccccgagcgcgtcaagaactat
ctgaaggaagccaagctctccgaccagctgcctctgatcatcgtttgcgatcgttttgac
tttgttcaagacttggtcatgtacttgtacaagaacgaccaaaggaagttcattgaagta
tatgtgaccaaggtcaaccccaagcgtctgcccgccgttgttggtggcctcatggacgtc
gactgctcggaggacacgatcaagaacttgatcatggtcgttcgcggcgagttttcaacc
gatgacttggttgccgaggtggagaagcgcaaccgcctgaagatgctgctgccttggctc
gagggccgtgtgcaagaaggtgtgacagagcctgccacacataatgctttggccaagatc
tacattgacagcaacaccaatgccgagcgtttcctgaaggagaaccagtactacgacagt
gccgtcgtgggcaagtactgcgagaagcgtgacccccagatggcctttgtggtttacgag
cgaggcaactgcgatgatcagctgattgagatttgcaacgccaacgccctccacaagaac
ctggctcgctacctggtgcgccgtaaggactcagacctctgggcccgtgtgctggacgag
agcaacgaccaacgccgctcggtcattgatcaggtggtgcagactgcgctgttggaagcc
caagatccggacgaaatctccgttgctgtcaaggcgtttatcgcggccgacattccctct
gagctcattgagctgctcgagaagcttgtcatgggcgagtccatgttcagcaagaacagc
aacctgcaaaacctcttgatcgtgacggccatcaaggccgatggtgcacgcgtgtccgag
tacatcaaccgcctggacgactacgatgcctcgaccattgcccaggtggccattgagcac
tcgcagtttgaggacgcctttgccgtcttcaagaagtttgaggtgcacaccgaggctgtc
aaggttcttatcaatgatatcaagaacctggatcgcgcctacgagtacgctgagcgtgtt
aacaatgctgatgtgtggagccttttggccggcgcacagctgcgcgacggcatgatcaag
gaggccattgatagttacatcaaggccaacgacccgtctgccgtgcagggtgtcgtcatg
gctgccaagacgcatgacaagtttgaagacctcattcgctacctgcaaatggcgcgcaag
aaatcccgtgacgccgccattgagaccgagctcgtctttgcgtacgccaagacaaaccga
ctcgccgacatggaggagtttatcaccagccaacacattgccaacgtgcaggaggttggc
gaccgctgctacgacgagcaattgtgggaggctgccaagatcctctactctaatgcctca
aactttgcccgtctcagctccaccttggtgcacctcaaggagtaccaagcagccgtggat
gctgcccgcaaggccaacagcacgcgctcttggaaggaggtgtgcttcgcctgcgttgac
caccaggagttcaagatggcgcagatttgcggcctcaacatcattgttcatgccgacgaa
ctgggtgagctcatctcctattacctggtgcggggccactttgagccgcttattgccctc
ctcgaggccggcctcggccttgagcgcgcccacatgggtctctttaccgagcttgccatc
ttgtatggccgttaccaaccggagaagatgaaggagtacctcgagatgtactggtcgcgt
gtgaacattcccaaggtgctgcgcgccgccgaggaagctcacttgtggcccgagctcgtg
ttcttgtacgacaagtacgatgagtatgacaacgccgtcatcaccatgatggagcatccg
tccgaggcgtggcacgacaagcgtttcctcgagatgattgtcaaggtggccaacaccgag
ctgttttacaaggccgttgacttttacctgtcccacaagccgctcctgctcaacgacctg
ctgacggccgttgttggccgcattgatcatacgcgtgctgtcaagttgctcaaagaccgc
gacgtcgtggccatggccaagccttacctcaagactgtgcaacagaacgacaacgtggtc
gtgaacgaggcattgaacgacgtgctgattcatgagggtgactacgagggtcttcgtacc
tccatcgatggttacaagaactttgacaacattgccctggctcagcgattggaaaagcac
gagttgctcgagttccggcgcatttccgcatacctctacaagggcaacaaccgctggaaa
cagagcgtggacatttgcaagaaggatcgcctctacaaggatgccatgcagtacgcggct
gaatcgcgcgatcctgaggcggccaaggcattgcttgactactttgtcgagattgatgac
aaggaatgctttgcggcatgctgctttgcctgctacgatctcttgcgtccggatgtcgtg
accgagcttgcatggcgcaacggcatgatggactttgccatgccctacctgatccaggtc
atgcgcgagtacatggacaaggtggacaagctggacacccatcacattgagaagaaggcc
gaggaggagtctcaaccacctgcaccagccctgggtatgcctcagctcatgctgactggc
ccaggcatgatgggtggcatgatgggtggtatgcaagggggcatgccccagggtggtatg
ccccagggtggcatgtattaa

DBGET integrated database retrieval system