KEGG   Monosiga brevicollis: MONBRDRAFT_19302Help
Entry
MONBRDRAFT_19302  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
mbr  Monosiga brevicollis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MONBRDRAFT_19302
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MONBRDRAFT_19302
Enzymes [BR:mbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     MONBRDRAFT_19302
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MONBRDRAFT_19302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 754 aa AA seqDB search
MLLKALSSAFTAAPRRSVLASPSVLAIRNLHRVKHRSEIADPRKCNRVVIKLGSAVITRT
DEYGLALGRLASIIEEVAELQRQGREVILVTSGAVAFGRQLLAQQDALSRSIRQTLKKGT
FGSGIDPRACSAAGQGGLVSLYQAMFSQYGITCAQVLVTKNDFRDRRTLTHLNETMNALL
NIDVVPIINENDAVSPPAEDGADLDGVISVVDNDSLASNIANQMEADLMLLLSDVEGIYN
GPPKKAGSRLLERFAPNELDDISFGAGSKVGRGGMKAKVGAACWAWHKGVGVVIANGMRP
HVISEILQGKRVGTFFTDAISKSTDIETVAKSVRQGGRDLSVLPAQSRREIIERLADLLV
EREKDIMAANRRDVEEARENNTSTALLNRLSLTPAKLQSLAAGLRQIAGDADHHLGRVVK
RTQLADDLLLQQETVPIGVLMVIFESRPDCLPQVASLAIASGNGLLLKGGKEASRSNRVL
YSLVREALSLHANPDTVSLVESRDDVSALLELDGYIDLIIPRGSNDLVRSITEQANGVPV
MGHADGVCHVYLDAEADPEKALRVIIDAKTDYPAACNAMETLLVHKDLVESPTFKSIVTD
LRNAGVKINMGPRLFDAIGISGKPQTDFHIEYGEPECTIEIVDDVDAAIKHIHANGSSHT
EVILTENQDTAKRFLSSIDSACVFHNASSRFADGYRFGLGAEVGISTSRIHARGPVGVEG
LLTTKWKLYGDGQTAKDFSSGEKTFLHQSLPLQE
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcaaggctctgtcctccgccttcacggcggcaccgcgccgatctgtgctggcc
tcgccctcggtcctggccatccgtaaccttcaccgcgtgaagcaccgctcggaaattgcc
gatccacggaaatgcaaccgtgtggtcatcaagctcggctcggccgtcattacccgtacc
gacgagtatggcctcgctctcggccgcctcgcctctatcattgaagaggtcgccgaactt
cagcgccagggtcgtgaggtcatcctcgtcacgtcgggtgccgtcgcctttggccgtcag
ctcctggcccagcaagatgccctgagccgctccatccgccaaaccctcaagaagggtacc
tttggcagcggcattgaccctcgtgcctgctcggcagccggtcagggtggcctcgtgtcc
ctgtaccaggccatgttcagccagtatggcattacttgcgcccaggtgctcgtgaccaag
aacgacttccgtgatcgccgtaccctgacccacctcaacgaaaccatgaatgcccttctc
aacattgacgtcgtccctatcatcaacgagaacgatgccgtgtccccaccggctgaggat
ggcgccgacctggacggtgtcatttccgtcgtcgacaacgactcactcgcctcgaacatt
gccaaccaaatggaagccgaccttatgctcctcctctctgatgttgagggtatctacaac
gggccgcccaagaaggccggatcccgcctcctcgagcgcttcgctcccaacgagctcgat
gacatttcctttggcgccggctccaaggtgggccgtggtggcatgaaggccaaggtgggc
gccgcctgctgggcctggcacaagggtgtcggcgttgtcattgccaacggcatgcgcccc
cacgtcatctccgagatcctccagggcaagcgcgtcggtaccttcttcaccgatgccatc
tccaagtctactgatatcgaaaccgttgccaagtcggtccgccagggtggccgtgacctc
tccgtcctgcccgcccagtcccgccgtgagattattgagcgcctggctgacctcctcgtc
gagcgggaaaaggacattatggctgccaaccgccgtgacgttgaggaagcccgtgagaac
aacacctccaccgccctccttaaccgcctctccctcacccccgccaagctgcagtcgctt
gccgctggtctgcgtcagattgccggagatgccgaccaccatctcggtcgcgtcgtcaag
cgcacccagctggccgacgacctcctgctgcagcaggaaaccgtcccgattggcgtcctt
atggtcatcttcgagtcacgccccgactgcctgccccaggtggcttccctggccattgcc
agcggtaacggtcttttgctcaagggtggcaaggaggcttcgcgcagcaaccgtgtcctt
tactctctggtccgcgaagccctctccctccacgccaaccccgacaccgtgtctcttgtt
gagtcgcgcgacgacgtcagcgccctccttgagcttgacggctacattgacttgatcatc
ccccgcggcagcaacgacctcgtccgcagcatcaccgagcaagccaacggcgtgcccgtc
atgggccatgccgatggtgtctgccacgtctaccttgatgcggaagccgatcctgaaaag
gccctgcgcgtgattattgacgccaagaccgattaccccgccgcttgcaacgccatggag
acgcttctggtgcacaaggacctggttgagtcgcctaccttcaagtcaattgtcaccgac
ctgcgtaacgccggtgttaagatcaacatgggtcctcgcctctttgacgccattggcatc
agcggcaagccccagaccgacttccacattgagtacggagagcccgagtgcaccattgaa
attgttgacgatgttgatgccgccattaagcacatccatgccaacggcagctcgcacact
gaagtcatcctcactgagaaccaggacaccgccaagcgcttccttagcagcatcgactcg
gcttgcgtcttccacaatgccagctcgcgcttcgctgacggttaccgctttggcctgggt
gctgaggttggtatcagcacgtcgcgcatccatgcccgtggccccgtgggcgttgagggt
ctgctgaccaccaagtggaagctgtacggtgatggccaaacggccaaggacttctcctcg
ggcgagaagacttttttgcatcagagcctgcctctgcaagagtaa

DBGET integrated database retrieval system