KEGG   Monosiga brevicollis: MONBRDRAFT_19778Help
Entry
MONBRDRAFT_19778  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
mbr  Monosiga brevicollis
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mbr04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 328 aa AA seqDB search
MNSVLQCLLYARPLTMYFTQGRYRKDLNRTNPMGCKGELAEEYSALVVELNKRCYRYLAP
KFFKATLASFAPQFEGTQQQDAQEFASFFLDGLHEDLNRVRKKVCDCNLDGMPDHLAADK
AWNEYLTRHNSIIVDLFQGQYRSAMRCLTCGHESLNFSPFMFLTLPIPANPSVDIRACLQ
EFVRAERVNGWRCPKCKCARDASKTLSIWRLPPLLMIHLKRFTFSGPFRDKLSTRVDFPL
TNLKIQDGVANPKLQEQKRDYKLFGVSNHYGNMSGGHYIAFCRDFQSRRWYKFDDSAVSP
MPESQVCSNAAYLLFYSCLDFDHLGNSF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtgttcttcagtgtcttctttatgcgcgtccattgaccatgtactttacccaa
ggtcgctatcgcaaggacctcaaccgcaccaatcccatggggtgcaagggcgagctagcc
gaagaatattcggcgcttgtggtcgagttgaacaagcgctgttatcgctatttggcgccc
aagtttttcaaggctacgctggcttcctttgcgccgcagtttgagggcactcaacagcag
gatgctcaggagtttgcttccttcttcctggatggcttgcatgaggacttgaatcgcgtt
cggaagaaggtttgtgattgcaacttggatggcatgcccgatcacctggccgcagacaag
gcctggaatgagtatctgacacgccacaactctatcattgtggaccttttccaaggccaa
tatcgaagcgcgatgcgctgcttgacttgcggccacgagtcgctcaacttttctccattc
atgtttctcacgcttcctattccagccaatcccagtgtggatattcgggcttgtttgcaa
gagtttgtccgtgcagagcgcgtcaatggctggcgctgtcccaagtgtaaatgcgcccgg
gatgcgtccaaaacactgagcatttggcgcttgcctcccttgctaatgattcatctcaag
cgcttcacgttctcgggcccttttcgcgacaagctgtcgactcgggttgattttcctttg
acaaacctgaaaattcaagacggcgtggctaatccgaaacttcaggagcagaagcgcgat
tacaagctctttggcgtgtcaaatcactacggcaacatgagtggaggacactatattgcc
ttttgccgagacttccagtcccgtcggtggtataagtttgatgactcggccgtgagccca
atgcccgagagccaggtctgctccaatgctgcctacttgcttttttacagctgtttggac
tttgatcatctgggcaacagcttttag

DBGET integrated database retrieval system