KEGG   Monosiga brevicollis: MONBRDRAFT_2085Help
Entry
MONBRDRAFT_2085   CDS       T01042                                 

Definition
hypothetical protein
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     MONBRDRAFT_2085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 234 aa AA seqDB search
NRYTNILPNPRTRVRLEDEYEPWTSVSTYINANYIAGYSSQPREYIAAMGPLDNTIEAFW
RMVWMVKSPAIVMTTPMMEQGRVKCARYWPTVRYNEAKKVGDRIYGHISVAVCSGEQHPG
YILTHIRLRKGKEEQLLRHYWFQNWPDHGVPSAEGAHQVIAMMQNVRAFCEEQRQGPPIV
HCSAGIGRTGTFIAIDQAVRCLEETGEVDCLQIVANMRKHRGGMVQHPQQYEFI
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
aaccgttacactaatatcttgcccaatccacgcactcgcgttcgccttgaggatgagtat
gagccgtggacctccgtcagcacttacatcaatgccaactacatagccgggtatagtagc
cagccgcgcgagtacattgctgccatgggaccgctggacaacacgattgaggccttttgg
cgcatggtctggatggtcaaatcgccagcgattgtcatgaccactcccatgatggagcaa
ggccgggtcaaatgcgcccgatactggccgaccgtacgctacaacgaggccaagaaagtg
ggcgatcgtatctacggccacatctccgtggccgtttgcagcggtgaacagcatccaggt
tacattctgacccacatccggcttcgcaaggggaaagaagaacagttgctgcgccactat
tggttccaaaactggcccgaccacggcgtgccttcagctgagggtgcccaccaagtcatt
gccatgatgcaaaatgtccgcgccttttgcgaggagcagcggcaaggccctcctatcgtg
cactgcagcgccggtatcggacgcaccggcacctttatagcaatcgatcaagccgtgcgc
tgcctcgaggagaccggcgaggtggattgcctgcaaatcgtggccaatatgcgcaagcat
cgcggtggcatggtgcagcaccctcagcagtatgagtttatc

DBGET integrated database retrieval system