KEGG   Monosiga brevicollis: MONBRDRAFT_21129Help
Entry
MONBRDRAFT_21129  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mbr  Monosiga brevicollis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MONBRDRAFT_21129
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MONBRDRAFT_21129
  Amino acid metabolism
   00310 Lysine degradation
    MONBRDRAFT_21129
Enzymes [BR:mbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MONBRDRAFT_21129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 197 aa AA seqDB search
MSNIMEFRKKHKDAVLKKHDVKLGFMSAFMKASAWALQQEPAVNAFIDPDGKHILYHDYV
NISVAVATPRGLVVPVVRNVEKMSYVDIENEIASLGNKARNGDLAIEDMDGGTFTISNGG
VFGSLMGTPIINPPQSAILGMHGIFERPVAINGKVEIRPMMYVALTYDHRLIDGREAVTF
LRKVKEAVEDPRVLVLE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatcatggagttccgcaagaagcacaaggacgccgtcttgaagaagcacgat
gtcaagcttggcttcatgtctgcctttatgaaggcctcggcctgggctttgcagcaggag
cccgctgtcaacgctttcatcgacccggatggcaagcacatcctgtatcacgactacgtc
aacattagcgtggctgtggctacccctcgcggccttgtcgtcccggtcgtgcgcaacgtc
gagaagatgagctacgttgacattgagaacgagattgccagccttggcaacaaggctcgc
aacggcgacctggccattgaggacatggacggtggtaccttcaccatcagcaatggtggc
gtgttcggctctctcatgggtacccccatcatcaacccacctcagtctgccattttgggt
atgcacggcatttttgagcgccctgttgccatcaacggcaaggtggagatccgacccatg
atgtacgttgcgctgacgtatgaccatcgtctcatcgatggccgggaggccgttaccttc
ctccgcaaggtcaaggaggccgttgaggacccccgcgtcttggtgctggagtaa

DBGET integrated database retrieval system