KEGG   Monosiga brevicollis: MONBRDRAFT_21166Help
Entry
MONBRDRAFT_21166  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mbr  Monosiga brevicollis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MONBRDRAFT_21166
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    MONBRDRAFT_21166
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     MONBRDRAFT_21166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 428 aa AA seqDB search
MDRPLAHYIISSSHNTYLTGGQLNSASTVEIYRQVLLAGCRCLEIDIWNGDDGEPIVTHG
MTLCTQILFKDVMRAIAEYAFVNSPWPVILSFENHCNKEQMRKMATYCKEAFGQLLQSEF
LPGDGYDKLPRDLPSPRQLMYRIIIKNKKCKTSGSDEDAGHGDPDSSQDFSAQDDSITSD
NRDGDLGMHQEIDGEIETENEEELQRRKERTKEIAKELSDLVNYCTPYPFQDFVDYNKLQ
LSRIYPAGSRISSTNFNPQLFWNVGCQLVALNWQTMDRPMQINLGRFVENGRSGYCLKPP
ILCDPSKSFDPFEVSVIEGVVPVQMTIQVFSLQGIPRRDCQPIVNIQLIGLPEDTKAHVF
NTRPSRGRGLNPRWNSDNTFIVPRITLPEMSCLRFAVIDNKDQTLLGWAVLPVNSMRSGF
RYIPLEVS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggatcggcctttggctcactacatcattagttcatcccacaacacttatctgacgggc
gggcagctcaactcagccagtaccgtcgaaatctaccgccaggtgctgctggccggctgt
cgatgcctcgagattgacatttggaacggcgacgatggcgagcccatcgtgacccacggc
atgactctttgtactcaaatcctgttcaaagacgtcatgcgcgccattgccgaatacgcc
tttgtcaacagcccttggccggtgatcctgagtttcgaaaaccattgcaacaaagaacag
atgcgcaagatggctacgtactgcaaggaggcgtttggccagctcctgcaaagcgaattc
ttgcccggagatggctatgataaattgccgcgcgatttgccatctcctcgtcagctcatg
tatcgcatcatcatcaagaacaagaaatgcaagacttctggttccgatgaggacgccggt
catggcgatccagactccagccaagacttcagtgcccaagatgattcgattacctcggac
aaccgcgatggtgacttgggcatgcaccaggaaattgacggcgagattgagacggagaac
gaagaagagttgcagcgccgcaaggagcgcaccaaggaaatcgccaaggagctctctgat
ctggtcaattactgcacgccgtacccgttccaggactttgttgattataataaattacaa
ctctcccgcatttatcccgctggctcgcgcatctcttccaccaattttaaccctcaactc
ttttggaatgtgggttgtcaactagttgcactcaactggcaaaccatggatcggcccatg
caaatcaatttgggacgcttcgttgagaatggacgctctggctactgcttgaagcccccg
attttgtgtgacccgtccaagtcgtttgatcctttcgaagtatccgtcatcgagggcgtg
gtgcccgttcaaatgacaattcaggtgttttccctacaaggcatcccacgccgcgattgc
cagccaatcgtcaacattcagctcattggcttgccagaagacaccaaggctcatgttttc
aacacgcgacccagtcgcggccgtggcctcaatcctcggtggaactcggacaacaccttc
atcgtgccgcgcatcacacttccagaaatgtcgtgtctccgcttcgcagtcattgacaac
aaggatcaaacgctcctgggctgggccgtgttgcctgtcaactccatgcgctcagggttt
cgctacatccccctggaggtaagttga

DBGET integrated database retrieval system