KEGG   Monosiga brevicollis: MONBRDRAFT_22031Help
Entry
MONBRDRAFT_22031  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
mbr  Monosiga brevicollis
Pathway
Metabolic pathways
Brite
Enzymes [BR:mbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     MONBRDRAFT_22031
Glycosyltransferases [BR:mbr01003]
 Glycan extension
  Type 3 chain
   MONBRDRAFT_22031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 393 aa AA seqDB search
MARGDHDDDDPAIQAIADELMQEGYKANPPTARQPSAHLPQAQASHHQHPQHVDPIVHVI
KRESSNNNRAQAVSNALDQLNLHDMLEAPVEHANGQAVHDAAIRHPPATQPKDIPDYLLN
TMKDEPPYGTPPDETAKKDPSIYCFVLTTPKRHDPKAIAVNNSWGLRMDRLDFMTSEPYP
GLNTVLLRLRNESRKTLWPKIKLAWLHTYQHHLDDHDWFMKADDDTFVVVDNLRQFLAQY
DPNKPHFFGHRFLLHRGQGPQAELSYYSGGAGYVLSRAALKLLGDNAAKALTNNGLAEDV
EMARSMLKVGVTCEDSRDAEGHERFLPMNIDNMRYRYKFATKPKFWYWRYVYFPPKDGLQ
RCSNDQSASYTHTHSLSLSLSLSPCLSLFNRVS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtggggaccacgacgatgacgaccctgccatacaagccattgcggatgagttg
atgcaagagggctacaaggcaaatcctcccacagctcgtcaaccctctgctcacctcccg
caggcacaagcctcccatcatcagcatccgcaacatgtcgaccccattgtacacgtcatc
aagcgagaaagcagcaacaacaaccgggctcaagccgtatccaatgcgctggaccagctc
aatctccacgatatgcttgaagctcctgtggaacatgccaatggacaagccgtgcacgat
gcagcgattcgacatccacctgccacccagcctaaagacatccccgattatctcctcaac
acaatgaaggacgagccgccctatggcaccccgcccgatgagactgccaaaaaggaccca
agcatctattgttttgttctcactactcctaaacgccacgaccccaaggccatcgctgtc
aacaacagctggggtctacgcatggaccggctcgactttatgacttcagagccatacccg
ggcctgaacacggttctactgcgtcttcgcaatgagagccgtaaaaccctctggcccaaa
atcaagttggcttggcttcacacgtatcaacatcacctcgacgatcacgactggttcatg
aaggccgatgacgatacctttgtcgtggtcgacaacctgcgccagtttctcgcccaatac
gatcccaataaacctcacttctttggccaccggtttctgcttcaccggggccagggtcct
caggctgagctgtcgtactactcgggcggagctggctatgtactgagtcgagctgcgctg
aagctgctgggcgacaacgctgcaaaggcactcacaaacaacgggttggcagaagatgtc
gaaatggcgcgcagcatgctcaaggtcggcgtaacctgcgaggactcgcgggacgccgaa
ggccacgagcgcttcttacccatgaacattgacaatatgcgttaccgttacaaatttgcc
accaaacccaagttttggtattggcgctacgtctacttcccgcccaaggatggactgcaa
cgatgcagtaacgatcaaagcgcttcctacacacacacacactctctctctctctctctc
tctctctctccctgtctgtctctcttcaaccgcgtttcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system