KEGG   Monosiga brevicollis: MONBRDRAFT_22039Help
Entry
MONBRDRAFT_22039  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 828 aa AA seqDB search
MSSRRLPGGAVPESNGRASAEAPAATAVRGLRNLGNTCFYNAVIQSLARLHTLRTDLRLR
ADKAKQADDVDAEDKATGDQPVLLVPAPAHCLDAELNATLRSISLDVIPHMGQLAHSLLE
LLENLTAASGNQYVSVPTGSTSFMPRSSSAIHPLTSPPDPKPLFNAIVMKAPRFRGYQQQ
DSQELLRHLLDLMDDEDRTAVFGGKLASTIICHGCHQALSKKQKRKLEAQAKREEKQRRK
AERKQKKSDRGSSSAVAPTRGDAGAQKKARRATAAAATAIEADAGLHESNFNEQDEENSM
ASPQPLQGSPSPAELSSRPNSSDDAEHAQGNGDRGSGEEHGGHHAETDCESKVVSSFVQS
PCSDGIMQRRSVFRLSDGVGLASESSDWPDDADADEIDRSSEPRMTMLSGLATQLVQAAV
AAGMVQVTSYGKATTSTAGPGEASSLPRGALFTESTMDHDSYKGGQARTNGCDTPVHGQT
DARPHRNRTSSVVSVGTVSLDSMIMSDNVLTLPPRCGTLAPMYVPSPNESSVASCLAAFC
AKEELRGTNAFLCQECGRRAAADAAVQDAASALCPPPHGRLQMETQQGQSSETLTAVVGH
SDLVASNACLDDSDDMSGEPGLKHAFEDTSPVNEANGFASNVGSVRAFAKGGVSDVSSGT
DGTCSSPSMKSTPSPSKPIPPVAREASKQLLIELPPTVLTLHLKRFEQHGTRLSKSSRHV
SFPLVLDIAPFCSTECSMTVYSGKECGVRYELRSVVVHQGRLTGGHYVAYVRTDMEASTK
DTAAAQGPSQTSGSPSSWYCVSDASVRKVAEKEVLAAEAYILFYERLG
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtcgtcgcctccccggaggtgctgtgcccgagtccaatggccgtgcctctgct
gaggcaccagcagccacagcagtccgcggcctgcgcaacttgggcaatacgtgtttttat
aacgctgttattcagagtcttgcgcgcctgcatacactccgcaccgatctgcgcctgcga
gctgacaaggccaagcaggctgatgatgttgatgcagaagacaaggcgacaggagaccag
ccggtcctgctggtgccggccccggcgcattgcctagatgctgaattgaacgcaacgctt
cgttctatcagcctggatgtcataccgcatatgggccaactggcgcattctctgctggag
cttctcgagaatctcacagcagccagtggaaaccagtatgtcagcgtccctacaggctcc
acaagcttcatgccccgcagctcatcagcaattcatcctcttaccagccctccggacccc
aagccgctcttcaacgccatcgtgatgaaggcaccacgcttccgtggttaccagcagcaa
gatagtcaagagctacttcggcacttgctcgatttgatggatgacgaagaccggacggct
gtatttggcggcaagctcgcctctaccatcatttgtcacggctgtcatcaggccttgtcc
aagaagcaaaagcgcaagctcgaagctcaagcgaagcgggaggagaagcagcggcgaaaa
gctgagcggaagcaaaagaagtcggatcgtggcagcagctcagccgttgcacctactcgt
ggcgatgctggtgcccagaaaaaagctcggcgagccactgccgctgccgcaaccgcgata
gaagcagatgcaggtttgcacgagtcaaacttcaacgagcaggatgaggaaaattccatg
gcatcgcctcaacctttgcagggcagcccgtctccagcagagctttcttccaggccgaac
agcagcgatgacgccgagcatgctcaaggcaatggggacagaggctcgggcgaggagcac
ggcggtcatcatgctgagacagactgtgagagcaaagtggtttcaagcttcgtacagagc
ccatgctcggatggcatcatgcaacggcgctctgtatttaggctcagcgatggggtgggc
cttgcatcggaatcgagtgattggcctgatgatgctgacgcggacgaaatcgaccgctca
agtgagccgaggatgacaatgctgtcgggcctggccactcagctggtgcaagctgcagtg
gcggcaggaatggttcaagtgactagctatggcaaagcaacgactagtacggctggtccc
ggagaagcatcatcacttccccggggtgcactgtttacagagtcgacgatggatcacgac
tcgtacaagggcggtcaagccagaaccaacggctgtgatacaccggttcacgggcaaaca
gatgcgcggccacaccgcaatcgaaccagctcggtggtatcggttggtacggtatcattg
gattctatgatcatgtcagacaacgtcttaactcttcccccgcgttgtggtaccttggct
cccatgtacgttccaagtcccaacgaaagctcggtggcttcgtgtttggctgctttctgt
gccaaagaggaactgcgcggcaccaatgccttcctttgtcaagaatgcggacgccgtgca
gcagcggacgcggccgtacaggacgcagctagtgctctgtgtccacctcctcatggacgc
cttcaaatggaaactcaacagggacaatcttccgaaaccttgactgcagtggtggggcac
agcgaccttgtcgcttccaatgcgtgcttggacgattctgacgatatgtctggtgagccg
ggactcaagcatgcattcgaagatacatcgcctgtcaatgaggcaaacggctttgcgagc
aatgttggcagtgttcgggcctttgccaaaggcggcgtcagcgatgtctcatcagggacg
gacggcacatgctcttcgccgtccatgaaatcgacgccctctccttcaaagcccatccca
ccagtggcacgcgaggctagtaagcaactgctgattgagttgcctcccacggtcctgact
ctgcatcttaaacgctttgagcaacacggtacacgcctcagcaagagctctcgccatgtg
agcttcccgttggtgttggacattgctcctttttgtagcactgagtgctcgatgacggta
tactcgggcaaggaatgcggggtgcgctacgagctaagatcggtggttgtacaccaaggt
cgactcacaggagggcactatgttgcctacgtacggacggatatggaagcttcaacgaag
gatacagcggctgcccaaggcccgagtcagacgtcaggctcaccatcgtcatggtactgt
gtctctgatgcaagtgtgcgcaaggtcgcagagaaggaagtcctcgcggcagaagcatac
attttgttctacgagcgtttgggttag

DBGET integrated database retrieval system