KEGG   Monosiga brevicollis: MONBRDRAFT_23508Help
Entry
MONBRDRAFT_23508  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mbr  Monosiga brevicollis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mbr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 275 aa AA seqDB search
MRLVGVLGAWLAMLHGLAAGAGVESRDADVLRIGFGSCANQRKPNPMWRVMREAAPDLMV
LLGDNVYADSVIVPPLRTPATVEALEQSYAQLLSLPDFQALRADTPLLAVFDDHDYGKND
GDESWELRTTAQRLLQDTFDQDPRLGIASRRQQSAMYTVWRHQWHGLRVRIILLDNRSHK
SRQPRFYVSEHHAQDMLGPEQWSWLESELRTQSADLTIIGSGLQFVAQDKVAGEQWGRFP
ASRAKLLALLATTNTANVVFLSGDVHLAEMPLPRE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggttggggtccttggggcctggctggcaatgctgcacggtttggcagcaggg
gccggggttgagagtcgggatgcagatgtacttcgaattgggtttggatcctgcgccaac
cagcgcaaacccaatccgatgtggcgagtaatgcgagaagctgccccagatctcatggtg
ctgctcggtgacaacgtgtacgcggacagtgtcattgtgcccccgctacgcaccccagct
acggtcgaagccctcgagcaaagttatgcgcagctactctctcttcccgactttcaagca
ctccgcgccgacacaccactcctggccgtctttgatgaccatgactatggcaaaaacgac
ggcgacgaaagctgggagctgcgcaccacggcccaacgtttacttcaggataccttcgat
caagatccgcgtttaggaattgccagtcggcggcaacagagtgccatgtacaccgtgtgg
cgccaccaatggcatggccttcgtgtgcgcatcatcttgctcgacaatcggtcgcacaag
tcgaggcagccgcgattctacgtctcggagcatcatgctcaggatatgctgggccccgag
cagtggagctggcttgagtcggagctgcgtacgcagagcgcagacctcaccatcatcggt
tcggggctacaattcgttgcacaagataaggtggcgggcgagcaatgggggcgctttccg
gctagtcgcgccaaattattggcacttctggcaaccaccaacaccgccaatgtggtcttc
ctgtcaggagatgtgcaccttgccgagatgccacttcctcgggaatga

DBGET integrated database retrieval system