KEGG   Monosiga brevicollis: MONBRDRAFT_25125Help
Entry
MONBRDRAFT_25125  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mbr  Monosiga brevicollis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MONBRDRAFT_25125
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    MONBRDRAFT_25125
   00603 Glycosphingolipid biosynthesis - globo series
    MONBRDRAFT_25125
   00604 Glycosphingolipid biosynthesis - ganglio series
    MONBRDRAFT_25125
   00511 Other glycan degradation
    MONBRDRAFT_25125
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MONBRDRAFT_25125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1047 aa AA seqDB search
MLHPALSITADAELSLVAGAADRPYTLSWGGKSRTSMPLAQPFFAVTEITRAWRRASHMR
MSIRVCTDPVPLIHQIIVFVNDTATAAAKPADVDESYTLNITAPTILISAQTEWGALYGL
ETLTQLVHYNQTTHAHTISHGPLFIRDAPRFTWRGLLLDTANHYLSLDAIKTTLDGMAMV
KLNLLHWHIVDSYSFPMEVMQQQGLSQHGAWSASRVYRREDVDDVVRYARTRGIRVVPEI
DVPGHAASWGASDPGLVSTCPVVNGTDIGNINVIPLNVAEERVYQVLGDVLNATATHFPD
TTLHLGGDEVQFSCWTHDPLIQDFMTRHGLDELGLLIFFLNRTDALLPDSIQQVMLWDEM
FDNLGPRLPELAHCKPIIEVWNNRTLMDAALAQGHDVLLATGFYLDRQTPVDGRPTHWFW
VDTWVDMYEVELPEDRESPGRVLGGEACMWSEQVSDISLHTRLWPRLAGVAERLWSPADI
TDAALAAQRLGAVRCKMAARGVPIGPIWADYCSADTEFALISSTNHHNKPVQLTSGEMLA
ITLFMFLLGVFFVYIAACCFGIGFTVRPRDSNRTPLLPASTDSNIQSKSNIDLATDPVAP
KPPRERLSALDVYRGLTIAVMILVDETGAAFPPIDHAPWNGLHLADTVVPSFDFIVGVSI
ALAFKRFDLEAGAQGQRWTAFKKATDRFLKLFGGITFMNYDLTNIRIFGILQRVAVCYFA
VALMEIFLPRLTGALPADNGTWADWMRRTQHLFWRYRWHWFSAALLLAVHTSILYGVDVP
DAFGERCGRGQLTPACNAATYIDRLILTVPHMYFPENGGDPAHADVTFKRLPECSSCSPG
LCVAPADAPAWCLHGPFDPEGLVSSLTAIVTTIIGVHYGHVLRQIKSPMERIFQWSSFAL
LQLLLGLILHFSGIPLNINLYSVSFVLVTGGMTGLLLVLCYLIVDYRPTARWLWLPFMWL
GTNAIVIFLCAEGDVIDWVLSCFYLEDPDRSLANILWPTGVYWGDDDDVRPYKPSYNYQI
MLWCLAYIGVWVLLGRWMYNNKIFIKI
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacccagccttatccatcaccgctgatgcggaactgagcctcgtcgctggagct
gcggaccggccgtacacactcagctggggcggcaagagccgcacctcaatgcctctggcc
caaccgtttttcgccgtgaccgagatcaccagggcctggcgccgcgcctcacacatgcgc
atgtcaatccgcgtatgcacagatcccgtgcctttgattcatcaaatcatcgtgtttgtt
aatgatacggccacggcggctgctaaaccagccgacgttgacgaatcatataccctcaac
atcaccgccccgaccatcctcatttccgcccaaaccgaatggggtgcactctatggcttg
gaaactttgacccagctggttcactacaaccaaactacacatgcccacaccatttctcat
ggaccgctctttattcgtgatgccccacgcttcacctggcgtgggctgctcctggatacc
gccaaccattacctgagtctcgacgccatcaagacgactcttgatggcatggcaatggtc
aagctcaacctcctacattggcacattgttgattcatactcctttcccatggaggtgatg
caacagcaaggcctctcccagcacggtgcttggagcgccagtcgggtctatcgccgcgag
gacgttgacgacgtggttcgctacgctcgcacccgaggcattcgcgttgtcccagaaatt
gacgttcccggccacgctgctagttggggtgccagtgatccgggcctggtttccacgtgc
ccggtcgtgaacggcacagacattggtaacatcaacgtcatccctctcaacgtggccgag
gagcgcgtctatcaggtgcttggcgatgttctcaacgcgactgccacccactttccagac
accacgcttcatctgggtggtgacgaggtgcaattcagctgttggacccatgatccgttg
atacaagactttatgaccaggcatggcctcgacgaattaggactcttgatcttctttctc
aatcgcacggacgccctcctgcctgactccatccagcaagtcatgctgtgggatgaaatg
tttgacaacctcggcccacgccttccggaactggcccattgcaaacctatcatagaggtt
tggaacaaccgtacactcatggatgcggccttggctcaaggccatgacgttttgctggcc
acgggcttttatctcgatcgccagacaccagtagatggccgtcctactcactggttctgg
gttgatacctgggtggatatgtacgaggttgagcttcctgaagaccgtgaaagtcccggc
cgggtgcttggcggtgaagcttgcatgtggtccgaacaagtgtcggacatttccctgcac
acccgcctctggcctcgccttgctggcgtcgccgagcgcctgtggagtccagccgacatt
accgatgccgctttggcagctcagcggctcggcgcagtacggtgcaagatggcagctcgc
ggcgtccctattggtcccatttgggctgactactgcagtgcggataccgagtttgccctc
atctcaagtaccaaccaccataacaaaccggttcaattgaccagtggcgagatgcttgcc
atcacgctgttcatgtttctcttgggcgtattctttgtgtacattgcggcatgttgtttt
ggcattggctttaccgtgcgccctcgagactcaaatcgcactcccctccttcctgcctca
accgacagcaacattcagtccaaaagcaacatcgatctggccactgatcccgttgctcca
aagccaccgcgagaacgcttgtccgcgctcgacgtttatcgaggcctgaccattgcggtc
atgattctcgtggacgagacgggagctgcctttccacccattgatcacgcaccgtggaat
ggcttgcacttggccgacactgtcgtgccttcgtttgactttatcgtcggcgtctcaatt
gctctcgctttcaagcgttttgacctcgaggctggtgctcagggacaacgctggaccgcc
tttaaaaaggctacggatcgctttctcaagcttttcggtgggattacgtttatgaactac
gatttgaccaacattcgcatcttcggcattctacaacgtgttgccgtgtgctactttgcc
gtggcactgatggagattttcctgccgcgcctcaccggtgccctccctgctgacaatgga
acgtgggcagactggatgcgtcgcacccagcacctgttctggcgctaccgctggcactgg
ttttccgcagcgctgttgctggcagtacacacctctatcttgtatggcgttgatgtgccg
gacgcatttggtgaacgctgtggccgcggccagctcacacccgcctgcaatgcagccaca
tacatcgaccgccttattctgaccgtgccacacatgtattttccggaaaatgggggcgac
ccagcacatgccgacgtgacattcaagcgcctacccgagtgcagctcctgtagtccgggg
ctgtgtgtagcaccagctgatgcccctgcctggtgtcttcacggccctttcgacccggag
ggtctcgtctcctcgctgacagccatcgtcaccaccatcattggcgtccactatggacat
gtcttgcgccagattaagagcccgatggagcgcatctttcagtggagcagctttgccctg
ctgcaactattgctgggtctaatcttacatttcagtggtattcccctgaatattaacttg
tattccgtctcctttgtgcttgtgacgggcggcatgacggggctccttttggtgctttgc
tatctcattgtggattatcgacccactgcacgctggctgtggcttcccttcatgtggctt
ggcaccaacgccatcgttatctttctatgtgctgagggcgacgtgattgactgggttctg
tcgtgcttttaccttgaggatcctgaccgaagcttggcaaatatcctgtggcccacgggc
gtgtactggggcgatgacgacgacgtgcgcccgtacaaacccagctacaactaccagatc
atgctctggtgtttggcgtacattggcgtttgggtgctgctgggtcgatggatgtacaac
aacaagattttcattaaaatctaa

DBGET integrated database retrieval system