KEGG   Monosiga brevicollis: MONBRDRAFT_25446Help
Entry
MONBRDRAFT_25446  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
mbr  Monosiga brevicollis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MONBRDRAFT_25446
Translation factors [BR:mbr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    MONBRDRAFT_25446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 645 aa AA seqDB search
MRTLVRKLQIEVSRAALPVRATSPSCFDHKKYSPTITVGLDSLRKTSKNLAHSKSGSGAR
WSVRKPKRLGEDLLSSVHLPTARLSLMSWSRASIISPLHRSETLSDATLREFMIDHLIRE
GHYTTAMALADHSQVKALLDQDTFCRLQPVVQALESHNLESALAWCADHAAVLEKKRSTL
PFKLHAQRFVQLIENEDLAQAVEYAHNHLAPYGEAPFVNEERWHDLVDRFRRNAFVVLQA
NTGPAPLTLLASLGLAGLHTAACAPGKSSDCPTCSPLFQHLAKRLPVALHTQSVLVCRLK
GVRMDENNPPMVLPNGNVYSREFTCKLCCVVCVCVCVCVCVCVCVCVCVCVCVCVCVCVC
VCVCVCVCVYLCSWIRGLLSVLRPFGTENMSDWDASDFEAEAAEVEEKPKWDDEEPGAAE
PTTQELVPASKPPSKYNDMDREELLQVIARLEAQGPTQKKAPKKKKLKQILAEREAAEAA
RAEELAQAEQELTPEERAAAKIVERRQVEESHMDAAKDLFGGDEEEEEVVLFEAMQPKTK
EDFEKFARAIVKKARKYDVSPHYLDFVDALFRDLLENASSEKIRQAIKSVNVLANEKAKT
EKNKKTKSKPKKAQIQASRGAASSVAGFLDGDGYGDDYGDDLDFM
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactttggtccgcaagctgcaaatcgaggtcagccgcgctgcgctgcctgtgcgc
gccacatcgccatcttgtttcgatcacaagaaatattcgcccaccatcaccgttggcctc
gatagcttgagaaagacatccaagaatttggcgcactcaaagagcggctcaggcgctcgg
tggagcgtgcgcaagccgaagcgtcttggtgaggaccttctcagctcggttcatctgccg
acggcacgactatccctcatgagctggtctcgtgcatcaatcatttcccccctccatcgt
agcgaaactttgagcgatgcaactctgcgagagttcatgatcgatcatctcatccgcgaa
ggccattacaccacggccatggccctggctgaccacagccaggtcaaagccttgttagac
caggacaccttttgccgtttgcagcccgttgttcaggcccttgaaagccataatctcgag
tcggccctagcttggtgtgcggaccatgctgccgtgctcgagaaaaagcggagtaccttg
ccctttaagcttcatgcccaacgctttgttcagctgattgaaaacgaggacctcgcccaa
gccgtcgagtatgctcacaatcatctggctccatacggcgaagcaccttttgtgaacgag
gagcggtggcatgatctggtggaccggttccggcgcaatgccttcgtcgtgcttcaggcc
aatacgggacctgcccctttaactctgcttgcttcgctcggtctggccggcctacacaca
gctgcttgtgctccaggcaaatcaagcgactgcccgacttgttcgcccctgtttcagcac
ttggccaagcgtttgcccgtggcgctccatacccaaagtgtgctcgtttgtcggctgaaa
ggagtgcgcatggatgaaaacaatccacccatggttctccccaacggcaacgtttactct
cgagagttcacgtgtaagctgtgttgcgttgtgtgtgtgtgtgtgtgtgtgtgtgtgtgt
gtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgt
gtgtgtgtgtgtgtgtgtgtgtgtgtgtacctttgcagctggatcagaggcctgttgagc
gttttgcgaccttttggaaccgagaacatgagtgattgggacgcttccgattttgaggcc
gaggctgccgaggtggaggagaagcccaagtgggatgatgaggagcccggggctgccgag
ccgacgacccaagagctggtccctgcttccaagcctcctagcaagtataatgacatggat
cgcgaggagcttttgcaagtcatcgctcgccttgaggctcagggcccgacacagaagaag
gctcccaagaagaagaaactgaagcaaatcctggccgagcgtgaggctgccgaggccgcg
cgcgccgaagaactggctcaggccgaacaggaattgacgcccgaggaacgcgctgctgcc
aaaattgttgagcgccggcaggtggaagagtctcacatggatgccgcaaaggaccttttt
ggtggcgacgaagaagaggaggaagttgtgctttttgaggccatgcagcccaagaccaag
gaggatttcgaaaagtttgctcgtgccattgtgaagaaggctcgcaaatacgacgtctct
ccccactacctggactttgtggacgccctcttccgtgaccttctcgagaatgcttcctcg
gagaaaattcgccaagccattaaatcggtcaacgtgctggccaacgagaaggccaagact
gagaagaacaagaagacgaaatccaagccgaagaaagcgcagatccaggccagccgtgga
gcggcttcgtcagtggccggtttccttgatggcgatggttacggtgacgactacggagat
gatctcgatttcatgtaa

DBGET integrated database retrieval system